KEGG   Thermoanaerobacter brockii: Thebr_0901Help
Entry
Thebr_0901        CDS       T01409                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tbo  Thermoanaerobacter brockii
Pathway
tbo00051  Fructose and mannose metabolism
tbo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tbo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Thebr_0901
Enzymes [BR:tbo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Thebr_0901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ADV79482
UniProt: E8URF9
Position
920226..920873
Genome map
AA seq 215 aa AA seqDB search
MLMQSEREQIVEYGKKLITSNLTKGTGGNLSIYNREKGLMAITPSGMDYFEIRPEDIVVM
DLDGKRIEGDRTPSSEYEMHRIFYANRQDINAIIHTHPVYSTTLACLNWDLPPVHYLVAL
AGPNVRCAKYATFGTKELAENAFEAMKDRKAVLLANHGLLVGAEDLPNAFNISEQIEYVA
ELYYRAKSIGEPVILSEDEMKLMLEKFKTYGQVKK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
ttgctaatgcaatcagaaagggaacaaatagtagaatatggtaaaaaactcataacctct
aatcttaccaaaggtacaggtggaaacttaagtatttataatcgagaaaaaggattaatg
gctataactccttctggaatggattattttgaaattcgaccggaagatattgttgtgatg
gatttagatggcaaaaggatagaaggcgatagaactccttcctcggaatatgaaatgcat
agaattttttatgctaataggcaggatataaatgccattatacatacacatccagtgtat
tctactactcttgcctgtttaaattgggaccttccaccagttcactatttagtagcttta
gctggaccaaatgtgagatgtgcgaaatatgcgacttttggtactaaagaattagcggaa
aatgcttttgaagcaatgaaggacagaaaagctgttttattagctaatcatggattacta
gtgggagccgaagaccttccaaatgcttttaatataagtgaacagattgaatatgttgcg
gagttgtactatagagcaaagtccataggagaaccggtaattctttctgaagatgagatg
aaattgatgttagaaaaatttaaaacttatggacaagttaaaaaataa

DBGET integrated database retrieval system