KEGG   Thermoanaerobacter brockii: Thebr_1002Help
Entry
Thebr_1002        CDS       T01409                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
tbo  Thermoanaerobacter brockii
Pathway
tbo00030  Pentose phosphate pathway
tbo00480  Glutathione metabolism
tbo01100  Metabolic pathways
tbo01110  Biosynthesis of secondary metabolites
tbo01120  Microbial metabolism in diverse environments
tbo01130  Biosynthesis of antibiotics
tbo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Thebr_1002
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Thebr_1002
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tbo04147]
    Thebr_1002
Enzymes [BR:tbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Thebr_1002
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Thebr_1002
Exosome [BR:tbo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Thebr_1002
  Exosomal proteins of colorectal cancer cells
   Thebr_1002
  Exosomal proteins of bladder cancer cells
   Thebr_1002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ADV79579
UniProt: E8URY2
Position
1032626..1034083
Genome map
AA seq 485 aa AA seqDB search
MVKNNISNIMVIFGGTGDLTHRKLIPALYNLKYQKILPENFAIVSIGRRDRTEEQYRNEV
LESIKNYSRFDIDEKVWQNLSERIFYKRFDFVYDNGYIELSSFLKDLDEEYNTKGNRIYY
LAVAPEYFGIIVEKLYRHGMVNNETSWQRVVIEKPFGENLESARKLNKMITDVFTERNTY
RIDHYLGKEMLQNIMVIRFANVFFEPVWNRRYIDNVQISSSETVGIENRGGYYEKAGALR
DMVQNHMMQLLTLTAMEPPVNLDTESIRDEKVKVLKSLEIFTREAVEKNVVRGQYVGYRQ
EDKVSPTSNTETFVALKVHVENFRWAGVPFYIRTGKRMPEKSTQIVIQFKPLPGILYFKE
YKNLLPNLLVIKIQPEEGVKLQFNAKVPGAGDITIQPVDMDFCQNCQISSNSPEAYERLL
YDVMRGDSTLFTRWDEVEYSWKFVDAIAEAWKDKTPDFPNYQPGTWGPKEASELLLRDNR
MWWNV
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggttaaaaataatatatctaatataatggttatatttggcgggacaggggatttaact
cacagaaaacttatacctgctttgtacaatttgaaataccaaaaaattcttcctgaaaat
tttgctattgtatccataggaaggagagatagaacagaagaacaatatagaaacgaagta
ttagagtcaattaaaaattattcgagatttgacattgatgagaaagtttggcaaaattta
agtgagaggatattttataaaaggtttgattttgtatacgataatggatatatagagcta
agttcttttttaaaggacctcgatgaagaatataatacaaaaggcaataggatatattat
cttgcagtagctccagaatattttggtataattgttgaaaaactttataggcacggcatg
gtaaataatgagacctcttggcaaagagtggttatagaaaaaccttttggagaaaacttg
gaatcggcgcggaaattaaataaaatgataactgatgtttttacagagagaaatacctat
aggatagatcattatctgggaaaagaaatgcttcaaaatataatggtaattagatttgct
aatgtattttttgagcccgtatggaacagaaggtatattgataatgttcagatttcttca
agtgaaacagtcggaatagaaaatcgcggtggatattatgaaaaagctggggccttacga
gatatggtacaaaatcacatgatgcaacttctaactttaacggcaatggaaccgcctgta
aatctcgatacagagtctataagagatgagaaggtaaaagttctgaagtctttagagata
tttactcgcgaggctgttgagaaaaatgttgtgagagggcaatatgtaggatatagacaa
gaagacaaagtttcccctacttctaatacagagacatttgtagctttgaaagtgcatgtg
gaaaattttcgctgggcaggagtacctttctacattcgcacaggcaaaagaatgccggaa
aagtctacacaaattgtaatacagttcaaaccgttgccaggaatcttgtattttaaagaa
tataaaaatttattgccaaatttattagttataaaaattcaacctgaggaaggtgtaaag
cttcaatttaatgcaaaagttcctggggcaggagatatcaccatacaacctgtagatatg
gatttttgtcaaaattgccagatttctagtaattctccagaagcttatgaaagacttctt
tacgatgtcatgagaggagattctactttatttacgcgatgggatgaggtagaatattct
tggaagtttgtagatgctattgctgaagcatggaaagacaaaacgcctgactttcctaat
tatcaaccggggacatggggacctaaagaagcaagtgagctgttactaagggacaataga
atgtggtggaatgtataa

DBGET integrated database retrieval system