KEGG   Thermoanaerobacter brockii: Thebr_1070
Entry
Thebr_1070        CDS       T01409                                 

Definition
(GenBank) hypothetical protein
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
tbo  Thermoanaerobacter brockii
Pathway
tbo00472  D-Arginine and D-ornithine metabolism
tbo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Thebr_1070
Enzymes [BR:tbo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Thebr_1070
SSDB
Motif
Pfam: OAM_alpha DUF2067 Lys-AminoMut_A RTC
Other DBs
NCBI-ProteinID: ADV79646
UniProt: E8USB7
Position
1098822..1099136
AA seq 104 aa
MKRVDDFETRSKHLQHMTDEELDAYFWELAEKIVDPLIESAYYHTSPSIERSVLLRMGFS
GIEAKEIVNRIEERGLLPKGAGNIVLKVAERLKKRLPCCWKSHS
NT seq 315 nt   +upstreamnt  +downstreamnt
gtgaaaagagtagacgattttgaaacgaggagtaaacatcttcaacacatgacagatgaa
gaattagacgcatatttctgggaattggcagaaaaaattgtagaccccttgatagagtcg
gcatattatcacacatctccatctattgagcgttctgtgcttttacgaatgggtttttct
ggtattgaggcaaaggagattgtaaacagaattgaggaaagagggcttttgccaaaagga
gcaggaaatattgtgttaaaagttgcagaaagactcaaaaaaagattaccttgctgctgg
aaaagccatagctaa

DBGET integrated database retrieval system