KEGG   Thermoanaerobacter brockii: Thebr_1376Help
Entry
Thebr_1376        CDS       T01409                                 

Definition
(GenBank) pseudouridine synthase, RluA family
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
tbo  Thermoanaerobacter brockii
Brite
KEGG Orthology (KO) [BR:tbo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:tbo03009]
    Thebr_1376
Enzymes [BR:tbo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     Thebr_1376
Ribosome biogenesis [BR:tbo03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Thebr_1376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 Cu-oxidase_3
Motif
Other DBs
NCBI-ProteinID: ADV79950
UniProt: E8UTW3
Position
complement(1376944..1377861)
Genome map
AA seq 305 aa AA seqDB search
MNIVDKIVLQGEKEDEGKRIDVFLAAELDYTRSYIKKLIVDGLVFVNGKTVKPSYKVKEN
DEVVLNVPEAEKIDVLPEDIPLDILYEDDDIIVINKPQGMVVHPAPGNYSGTLVNALLYH
CKNLSGINGILRPGIVHRLDKDTSGVMVVAKNDKAHISLSNQIKERSVFKKYVAIVEGVI
KDEEGKIEAPIGRHPVDRKKMAVIEDGRYALTLYKVLERFKENTLVEAVIKTGRTHQIRV
HMAYIGHPIVGDHVYGFKRQKFKLEGQALHSSVLGFMHPTKGVYMEFEAPLPEYFVRLIE
ILRNK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaacatagtagataagatagttttgcaaggagaaaaagaggatgaaggaaagagaata
gatgtctttcttgcggcagaattagattacacaaggtcttatattaaaaaattgattgtg
gatgggcttgtttttgtaaatggtaaaacggtaaagcccagctacaaggtaaaagagaat
gatgaggttgttttaaatgtcccagaggcagagaaaattgatgtactgccagaagatata
cctttggatattctttatgaagacgatgatataattgtgataaataagccacagggaatg
gtagtgcatccggcgccgggtaattacagtggtacacttgttaatgcacttctttaccac
tgtaaaaatttatcgggaattaacggcattttaaggccgggtatagttcacaggcttgat
aaggatacctctggtgtgatggttgttgctaaaaatgataaggcccacataagcctttct
aatcaaataaaagagagaagtgtttttaaaaaatatgttgctattgtagagggagttata
aaagatgaagaggggaaaattgaggcacctataggaaggcaccctgttgacagaaaaaag
atggctgtaatagaggatggaagatatgctcttacattgtacaaagttttggagcggttt
aaagaaaatacattagtagaggcggttataaagacaggtaggactcatcagataagagtg
catatggcttatataggacatcctattgtaggagaccatgtttatggctttaagaggcaa
aagtttaagttggaaggacaggcattacattcaagtgttttaggatttatgcatcctaca
aaaggagtttacatggagtttgaagctccacttcctgagtattttgtaaggttgattgaa
atattgagaaacaaatag

DBGET integrated database retrieval system