KEGG   Thermoanaerobacter brockii: Thebr_1948Help
Entry
Thebr_1948        CDS       T01409                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
tbo  Thermoanaerobacter brockii
Pathway
tbo00860  Porphyrin and chlorophyll metabolism
tbo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Thebr_1948
Enzymes [BR:tbo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Thebr_1948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 SNO Peptidase_S51 GATase_5
Motif
Other DBs
NCBI-ProteinID: ADV80468
UniProt: E8UWU1
Position
complement(1940879..1942402)
Genome map
AA seq 507 aa AA seqDB search
MTLKLMVQGTASSVGKSLLVAAFCRIFKQDGYRVAPFKSQNMALNSYITDEGLEIGRAQA
MQAEAAGIKPSYHMNPILLKPSSDRMSQVILRGKVYKNISAAEYHQFKPELLKLIKEDFD
FLASQNDIVVIEGAGSPAEINLRDRDVVNMGMAEMTNAPVLLVGDIDKGGVFASIAGTLL
LLKENERNRIEGVLINKFRGDIEILKPGLKMLEDIIHKKVLGVVPYMDVHIDEEDGSTER
FYRRNTEGDIEIAVINLPHISNFTDFEPLAKIPGIKLRYVNKGERIGDCDVVIIPGTKNT
IGDLQALKEYRIDKEIFEMRKKGKFIVGICGGYQMLGKVIKDPGRIESTTSEIEGLGLLD
IETVIENEKTTTQIKAVIRNNLPSILSPLRNIAVEGYEIHMGQSRILGDCQPFSVITHRN
GEKVEVYDGCISDDGKVFGTYIHGIFENREFVREFINIVRKSKGLSPIEEIIDYKEFKER
EYDKLADIVRKSIDMKEVYKIMERYRD
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacacttaaactaatggtacaaggaactgcctcttcagtaggtaaaagcttattggtt
gctgctttttgcagaattttcaagcaagatggttacagagtagccccttttaagtctcaa
aatatggctttaaattcctatataactgatgagggattagaaatagggagagctcaagcc
atgcaggcggaagctgcaggtatcaagccttcttatcacatgaatccaatccttttaaag
cccagctctgatagaatgagtcaggtgattttaagaggcaaagtttataaaaacatatct
gcagctgaataccatcaatttaagcctgaacttttaaagcttattaaagaggactttgat
tttcttgcaagtcaaaatgacattgttgtaatagaaggagctggaagccctgcggaaata
aatttaagggatagagatgttgtaaacatgggtatggcagagatgacaaatgcgccagta
cttcttgtaggagatattgataaaggcggtgtatttgcttcaatagctggtactttgctc
cttttaaaagaaaatgagagaaatcgcattgaaggtgtacttataaacaagtttagagga
gacattgaaatattaaagccgggcttaaagatgttagaagacattatacacaaaaaggtt
ttaggtgttgtcccttatatggatgtgcacattgatgaagaggatgggtcgacggagaga
ttttatcgtaggaatacagaaggagatatagaaattgcagttataaatcttccccacata
tcgaattttacggattttgaacctcttgctaaaattcccggaataaagcttcgctatgtg
aataaaggggaaagaattggagattgtgatgtggttataattccgggaacaaaaaacaca
attggagatttgcaagcattgaaagaatataggattgataaggaaatttttgaaatgaga
aaaaaagggaaatttatagtcggcatttgtggaggataccaaatgctgggaaaagtcatt
aaagacccgggaagaattgaaagtacaacttcagaaattgagggacttggacttttggat
atagagactgtaattgaaaatgaaaagacaacaacccaaattaaggcggttattcgcaat
aatttaccatcaatattatcacctcttagaaatattgctgtagagggatatgaaatacac
atggggcaaagtcgaattttgggagattgtcagcctttttcagtaataactcatagaaat
ggagaaaaggtcgaagtctatgacggttgtataagcgatgatggaaaagtgtttggaact
tacatacacggaatttttgaaaacagagagtttgtcagagaatttataaatattgtgaga
aaatcaaaaggactttctcctatagaggaaattattgattacaaagaatttaaagaaaga
gaatatgataagcttgcagatattgtgagaaaaagtatcgacatgaaagaagtctataaa
attatggagaggtatagagattaa

DBGET integrated database retrieval system