KEGG   Trypanosoma brucei brucei: Tb09.160.0480
Entry
Tb09.160.0480     CDS       T01013                                 

Definition
(RefSeq) serine/threonine protein phosphatase, putative
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
tbr  Trypanosoma brucei brucei
Brite
KEGG Orthology (KO) [BR:tbr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tbr01009]
    Tb09.160.0480
Enzymes [BR:tbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Tb09.160.0480
Protein phosphatases and associated proteins [BR:tbr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     Tb09.160.0480
SSDB
Motif
Pfam: Metallophos Metallophos_2
Other DBs
NCBI-GeneID: 3660329
NCBI-ProteinID: XP_803443
UniProt: Q38FZ2
Position
9
AA seq 431 aa
MSSGASHHELTRGRDGLKEREYVWKKSHADESPGSNPQILPTLVLPHHLVFDNDGAPLAD
NIKVHFGRGWRLHVEDALNIVHRCALIMKEEPNVVRLKGSAVVCGDLHGQFHDLLTLLEV
NGHPSVQQYVFLGDYVDRGDFSAEIVLLCMSFKLLYPRSFILLRGNHESRQLTSCFNFKQ
EIESKYSSMVYEEIMAAFDCFPLSCVVNDRFFCVHGGLSPLLTYLGEIDTVNRFRETPST
GPMCDLLWSDPMFGDDTDCATPSEELFVFNTKRGCSYNYSYEAVCRFLEANNLCTVIRGH
ETQPGGYKLYRHTPKGVPAVVCVFSASNYCGTYGNMAAVVAIDGDVMNIRQYMATSHDSC
TPNHFNAISRMQPLAIHEAVEKWCVASHGGSSGDAKAEKVEVEKNLSEDDSSVVLREKLG
DMICAMHHIVT
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgtcgagtggtgcttcacaccatgagctaacacgtgggcgtgatggtttgaaggaacgg
gaatatgtttggaaaaaatctcatgcagatgaatctcccggcagtaatcctcagatactt
ccgactctcgtgttgccgcaccatttggtatttgataatgatggcgccccgcttgcagat
aatattaaagttcattttgggagaggatggcgacttcatgtagaggatgcattgaacatt
gtccaccgctgtgcattaatcatgaaagaggagccaaatgttgtacgattaaagggatct
gctgtcgtgtgtggggatcttcacgggcagtttcatgacttactgacattgttagaagtt
aatggtcatcccagcgtgcagcaatatgtttttcttggagactacgtggaccgcggggat
tttagtgcagaaattgtactcctctgcatgtcgtttaagctactgtaccctcgttccttc
atactactacgtggcaatcacgaatcacgacaactaacgtcgtgtttcaacttcaagcag
gagattgagagcaagtattcgtcaatggtgtacgaagagattatggcagcgtttgactgc
tttccactctcatgtgttgtaaatgataggtttttctgtgtgcacggcggtttatcgcca
ttgttaacttatcttggagaaattgacactgttaaccgtttcagggaaacaccgtcgacg
ggtcccatgtgcgatttgctctggtctgatcccatgtttggagacgacaccgactgtgca
actccctctgaagagttgtttgttttcaataccaaacgtggttgctcatacaactacagt
tatgaggcagtttgtcggtttctggaggcgaataatctttgcacagtcatacgtggccac
gagacgcagccgggaggttacaaactgtatcgtcacaccccgaagggagttccagctgtg
gtttgtgttttttccgcatcgaattactgtggaacgtatggaaatatggctgccgtggta
gcaattgatggggacgtgatgaatattcgtcaatatatggcgacctcccatgactcctgc
actccaaatcattttaatgcaattagtcgtatgcaaccattggcaatacacgaggcagtt
gaaaaatggtgtgtggcttcacacggcggaagtagtggtgatgcaaaggcagaaaaggtg
gaagtagaaaaaaatctttcggaggatgattcttctgtggtactgcgggagaagttgggg
gatatgatttgtgcgatgcatcatatagttacttga

DBGET integrated database retrieval system