KEGG   Trypanosoma brucei: Tb10.70.6470Help
Entry
Tb10.70.6470      CDS       T01013                                 

Definition
(RefSeq) methionyl-tRNA synthetase, putative
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
tbr  Trypanosoma brucei
Pathway
tbr00450  Selenocompound metabolism
tbr00970  Aminoacyl-tRNA biosynthesis
tbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Tb10.70.6470
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Tb10.70.6470
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tbr01007]
    Tb10.70.6470
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tbr03016]
    Tb10.70.6470
Enzymes [BR:tbr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Tb10.70.6470
Amino acid related enzymes [BR:tbr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Tb10.70.6470
Transfer RNA biogenesis [BR:tbr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Tb10.70.6470
 Prokaryotic type
   Other AARSs
    Tb10.70.6470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 3662741
NCBI-ProteinID: XP_822407
UniProt: Q38C91
Structure
PDB: 

Position
10
AA seq 773 aa AA seqDB search
MALKLLSEKANSQALKVLLCSYYVKRPVEVSLSGAYATPILHHPAFKQPIIAPNEMARVI
LFYSVEPTSNNGGAADSSNGDGTASPVAGLTNLTLEHETWLEWEATTFTRAVHPLYTQRR
QTAESLAVFSYLDKKISENDDRCVYSPAVEGKGAADPTDAVSTFFIDCIVWCAVLPALCE
SGVLRDSEKQQLPHLVKWFNTFQKEQKTLIDNAFENLSVQEAADFLRCPRVYKVSAKVEK
VFFVTSPIYYVNAAPHIGHVYSTLITDVIGRYHRVKGERVFALTGTDEHGQKVAEAAKQK
QVSPYDFTAAVAGEFKKCFEQMDYSIDYFIRTTNEQHKAVVKELWTKLEQKGDIYLGRYE
GWYSISDESFLTPQNITDGVDKDGNPCKVSLESGHVVTWVSEENYMFRLSAFRERLLEWY
HANPGCIVPEFRRREVIRAVEKGLPDLSVSRKKETLHNWAIPVPGNPDHCVYVWLDALTN
YLTGSRLRVDESGKEVSLADDFSELERFPADVHVIGKDILKFHAIYWPAFLLSAGLPLPK
KIVAHGWWTKDRKKISKSLGNVFDPVEKAEEFGYDALKYFLLRESGFSDDGDYSDKNMIA
RLNGELADTLGNLVMRCTSAKINVNGEWPSPAAYTEEDESLIQLIKDLPGTADHYYLIPD
IQKAIIAVFDVLRAINAYVTDMAPWKLVKTDPERLRTVLYITLEGVRVTTLLLSPILPRK
SVVIFDMLGVPEVHRKGIENFEFGAVPPGTRLGPAVEGEVLFSKRSTENTKST
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atggctctaaagctgctttcagaaaaggccaactcacaagccctcaaggtgttgctgtgc
tcttattacgttaaacgacccgtagaggtgtcgctatcgggagcatatgcaactcctatt
ttgcaccatccagccttcaagcagcccatcattgcacctaacgaaatggcccgcgtcatt
ttattttacagcgttgaacccactagtaataatggaggggcagcagattcatctaatggt
gacggtaccgcctctcccgttgccggtttgacaaacctgacattggagcacgagacgtgg
ttggagtgggaggcaacgacttttacccgtgctgtgcacccgctctacacgcaacgacgg
caaacggcggagtctctggctgtgttttcatatctcgacaaaaagattagtgaaaatgat
gaccgctgtgtttactctccagctgttgaaggtaaaggggctgcggatcccaccgatgcc
gtcagcacttttttcattgactgtattgtatggtgtgctgtccttcctgctctctgcgag
agcggtgtgctgcgggactcggagaagcaacagctaccgcatcttgtgaagtggttcaat
acatttcaaaaggaacagaagacgttgattgataacgccttcgagaacctctctgtgcag
gaagctgccgacttcttgcggtgcccacgtgtgtacaaggtgtcggctaaggtggagaaa
gtattctttgtcacatcacccatttactacgtgaatgcagcaccacacattggtcacgtg
tacagcactttgattaccgacgtcattgggaggtaccaccgcgtgaagggagagcgggtg
tttgcattgactggcaccgatgaacacgggcagaaggtagccgaagctgccaagcagaaa
caggtttctccgtatgattttacggctgctgtggctggcgagttcaagaagtgttttgaa
cagatggattacagcatcgactacttcattcgcaccaccaatgagcaacacaaggcggtg
gttaaggagctatggacgaagttggagcagaaaggtgacatctatctcggccgttatgaa
ggttggtattcaatcagtgatgagtccttccttacgccacagaacatcacggacggagtt
gacaaggatggcaatccatgcaaagtgagcctcgaaagtgggcacgtcgtaacgtgggtc
tcagaagaaaattatatgttccgcctgagcgcgttccgcgagaggcttttggaatggtac
catgccaaccccggttgcatagtgccagagtttcgcagaagggaggtaattcgcgcggtg
gagaagggcttgcctgacctgagtgtctcccgcaagaaggaaacactgcacaactgggcg
atacccgttccaggcaacccagaccactgcgtttatgtctggctcgacgctctgacgaat
tatttaactggttcacgtcttcgagtagatgaatccgggaaggaggtgagcctagcggat
gactttagcgagctcgagcgcttccctgctgatgttcacgttattgggaaagacattttg
aagttccacgcaatttactggcctgcgttcctgctctctgctggccttccactacccaag
aagattgtcgcacatgggtggtggacaaaggatcgcaagaagatcagcaaatccctcggg
aacgttttcgatccggtggagaaggcagaggagtttggttacgatgcgcttaagtacttc
ctgcttcgggagtcgggcttctccgatgatggtgactacagtgacaagaacatgattgcc
cgccttaatggtgagcttgctgatacgctcggcaatcttgtcatgcggtgcacttctgcg
aagataaatgttaacggcgagtggcccagtcctgcggcttacaccgaggaggacgagtcc
ctcatacaactcattaaggatttgcctggaacggcggatcactactacctgattcccgac
atacagaaagctatcattgccgttttcgacgtgctacgtgccatcaacgcttacgtcacc
gacatggcgccatggaaactcgtcaaaacagacccggaacggctccgcacggtgctgtac
attaccctggagggtgtacgcgtgacgacgctgctcctttccccaattcttccgcggaag
tccgttgttatttttgacatgttgggcgtccccgaggtacatcgtaaaggtattgagaac
tttgagtttggtgccgttcctcctggaacgcgtctcggccccgcagtggagggcgaggtg
ctgttcagcaagcgctcaacagagaatacaaagagtacataa

DBGET integrated database retrieval system