KEGG   Trypanosoma brucei: Tb11.01.3110Help
Entry
Tb11.01.3110      CDS       T01013                                 

Definition
(RefSeq) heat shock protein 70
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
tbr  Trypanosoma brucei
Pathway
tbr03040  Spliceosome
tbr04141  Protein processing in endoplasmic reticulum
tbr04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:tbr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    Tb11.01.3110
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Tb11.01.3110
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Tb11.01.3110
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tbr01009]
    Tb11.01.3110
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tbr03041]
    Tb11.01.3110
   03009 Ribosome biogenesis [BR:tbr03009]
    Tb11.01.3110
   03110 Chaperones and folding catalysts [BR:tbr03110]
    Tb11.01.3110
   04131 Membrane trafficking [BR:tbr04131]
    Tb11.01.3110
   03051 Proteasome [BR:tbr03051]
    Tb11.01.3110
   03029 Mitochondrial biogenesis [BR:tbr03029]
    Tb11.01.3110
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tbr04147]
    Tb11.01.3110
Protein phosphatases and associated proteins [BR:tbr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Tb11.01.3110
Spliceosome [BR:tbr03041]
 Complex B
  Other components
   Prp19 complex
    Tb11.01.3110
 Complex C
   Prp19-CDC5 complex
    Tb11.01.3110
Ribosome biogenesis [BR:tbr03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    Tb11.01.3110
Chaperones and folding catalysts [BR:tbr03110]
 Heat shock proteins
  HSP70 / DNAK
   Tb11.01.3110
Membrane trafficking [BR:tbr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    Tb11.01.3110
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    Tb11.01.3110
Proteasome [BR:tbr03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    Tb11.01.3110
Mitochondrial biogenesis [BR:tbr03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    Tb11.01.3110
Exosome [BR:tbr04147]
 Exosomal proteins
  Proteins found in most exosomes
   Tb11.01.3110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Asp_decarbox
Motif
Other DBs
NCBI-GeneID: 3665039
NCBI-ProteinID: XP_829198
UniProt: Q383E5
Position
11
AA seq 690 aa AA seqDB search
MTYEGAIGIDLGTTYSCVGVWQNERVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA
MNPTNTVFDAKRLIGRKFSDSVVQSDMKHWPFKVVTKGDDKPVIQVQFRGETKTFNPEEI
SSMVLLKMKEVAESYLGKQVAKAVVTVPAYFNDSQRQATKDAGTIAGLEVLRIINEPTAA
AIAYGLDKADEGKERNVLIFDLGGGTFDVTLLTIDGGIFEVKATNGDTHLGGEDFDNRLV
AHFTEEFKRKNKGKDLSSNLRALRRLRTACERAKRTLSSAAQATIEIDALFENIDFQATI
TRARFEELCGDLFRGTLQPVERVLQDAKMDKRAVHDVVLVGGSTRIPKVMQLVSDFFGGK
ELNKSINPDEAVAYGAAVQAFILTGGKSKQTEGLLLLDVAPLTLGIETAGGVMTALIKRN
TTIPTKKSQIFSTYSDNQPGVHIQVFEGERTMTKDCHLLGTFDLSGIPPAPRGVPQIEVT
FDLDANGILSVSAEEKGTGKRNQIVITNDKGRLSKADIERMVSDAAKYEAEDKAQRERID
AKNGLENYAFSMKNTINDPNVAGKLDDADKNAVTTAVEEALRWLNDNQEASLDEYNHRQK
ELEGVCAPILSKMYQGMGGGDAAGGMPGGMPGVCPVVCPEEWVVGWEALRHRPGLKSRRL
TKFPGVFRTGAAVVSLSTVMVRRHIFSSSL
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgacatacgaaggcgccattggtatcgacctcggtacgacgtactcgtgcgttggtgtg
tggcagaacgaacgtgtggaaatcattgcaaatgaccagggtaaccgtacgacgccgtcc
tacgttgccttcacggactctgagcgcctgatcggcgatgcggcgaagaaccaggtggcg
atgaaccctacgaacacggtgttcgacgcgaaacggctgatcggacggaagttctccgac
tctgtcgtgcagtccgacatgaagcactggcccttcaaggtcgtcaccaagggcgacgac
aagccagtgatccaggtacagttccgcggtgagacgaaaaccttcaatcctgaggagatc
agttccatggtactattgaagatgaaggaggttgcggagtcgtatcttgggaagcaggtg
gctaaggctgtcgtaacagtgcctgcatacttcaacgactcgcagcgccaggcaacgaag
gacgcggggacgattgctggtctggaggtgctgcgcatcatcaacgagccaacggctgct
gcaattgcctatggcctggacaaggctgatgaggggaaggaacgcaacgtgctcatcttc
gatcttggtggtggcaccttcgatgtgacattgctgacgattgacggcggcatcttcgag
gtgaaagccacaaatggtgacacccaccttggtggagaagacttcgacaatcgccttgtg
gctcactttaccgaggaattcaagcgcaagaacaagggcaaggatctctcatcgaacttg
cgcgcccttcgccgccttcgtacggcttgtgagcgcgccaagcgcacactttcttccgct
gcgcaggcaaccatcgagatcgatgcactcttcgaaaacattgacttccaggcgaccatt
acccgtgctcgtttcgaggaactgtgcggtgacctgttccgtggtacattgcaacccgta
gagcgtgtgctgcaggatgccaagatggacaaacgcgccgtgcacgatgtggtcctggtt
ggtggttccacccgtatccccaaggtgatgcagcttgtgtctgactttttcggtggcaag
gagcttaacaagagcatcaaccccgacgaggcagtggcctacggcgctgctgtacaagct
ttcatcttgaccggtggtaagagcaagcaaacggaaggtctcctccttctggatgtcgcc
ccgcttacgctcggcatcgagacggcaggtggcgtgatgacggcactgatcaagcgcaac
acgacgatccccaccaaaaagagccaaatcttctccacatactcagacaatcagcccggt
gtgcacattcaggtctttgagggtgagcgtaccatgacgaaggactgccatctcttgggc
accttcgatctctctggaatccccccggcaccccgcggcgtgccacagatagaagtgacc
ttcgacctagacgctaatggtattcttagcgtttctgcggaggagaagggcactggcaag
cgcaaccagattgtcatcacaaacgacaagggtcgcctgagcaaggctgatatcgaacgc
atggtgtctgatgctgcgaagtatgaggctgaggataaggcgcagcgtgagcgcattgat
gctaagaacggtcttgagaactacgccttctcgatgaagaacactatcaatgaccccaac
gttgctggcaagcttgacgacgccgacaagaacgctgtcaccactgccgtggaggaggca
ctgcgatggctgaacgacaaccaggaggccagtttggatgaatacaaccaccgccagaag
gagctcgaaggcgtgtgtgctcccatcttatcaaagatgtaccagggcatgggcggtggc
gacgcggctggcggtatgcccggaggtatgcccggggtatgcccggtggtatgcccggag
gaatgggtggtgggatgggaggcgctgcggcatcgtccgggcctaaagtcgaggaggttg
actaagttcccaggtgtatttcggaccggtgctgcagtcgtctcattgtctacggtgatg
gtccgccgccacattttctcttcgtctctgtag

DBGET integrated database retrieval system