KEGG   Trypanosoma brucei: Tb11.01.3550Help
Entry
Tb11.01.3550      CDS       T01013                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase E2 component dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tbr  Trypanosoma brucei
Pathway
tbr00020  Citrate cycle (TCA cycle)
tbr00310  Lysine degradation
tbr01100  Metabolic pathways
tbr01110  Biosynthesis of secondary metabolites
tbr01130  Biosynthesis of antibiotics
tbr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tb11.01.3550
  Amino acid metabolism
   00310 Lysine degradation
    Tb11.01.3550
Enzymes [BR:tbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Tb11.01.3550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H HlyD_3 HlyD_D23
Motif
Other DBs
NCBI-GeneID: 3665072
NCBI-ProteinID: XP_829231
UniProt: Q383B2
Position
11
AA seq 383 aa AA seqDB search
MLRRLATHGLQATCLTSEKLAYRYCLSICVPTIAESISSGKVVGWTKKVGDAVAEDEIIC
QIESDKLNVDVRAPAAGVITKINFEEGTVVDVGAELSTMKEGEAPAAKAETADKPKQNAP
AAAAPPKASPTEAAPKPAPAAAPVTSRGADPRVRSVRISSMRQRIADRLKASQNTCAMLT
TFNEIDMTPLIELRNRYKDDFFKKNGVKLGFMSPFVKACAIALQDVPIVNASFGTDCIEY
HDYVDISVAVSTPKGLVVPVLRDVQNSNFAQIEKQIADFGERARSNKLTMAEMTGGTFTI
SNGGVFGSWMGTPIVNPPQSAILGMHATKKKPWVVGNSVVPRDIMAVALTYDHRLIDGSD
AVTFLVKVKNLIEDPARIVLDLA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgctccgtcgtttggccactcatggactccaagctacgtgcctgacttcggagaagttg
gcgtaccgctactgcctcagcatttgtgtccccactattgccgagtccatcagcagtggg
aaggttgtgggatggactaagaaggttggtgacgctgttgccgaagatgagattatttgt
caaattgagtcggacaaactcaatgtggatgtacgcgcccctgccgcgggtgtgatcacg
aagataaacttcgaagagggcactgttgtcgatgttggcgccgagctttcaaccatgaag
gaaggtgaggcccccgccgccaaggccgaaacagccgacaaaccgaagcagaatgcaccg
gcggcggcagcacctcccaaagcttccccaactgaagccgcgccaaagccagcgcccgcg
gctgctcccgtcacctcacgtggggcggacccgcgcgtacgtagcgttcgcatctcctcc
atgcggcagcgcattgcggatcggctgaaggcaagccagaacacgtgtgccatgctcacg
acattcaacgagattgatatgacccctcttatcgagttgcgcaatcgttacaaggatgat
ttcttcaagaagaacggggtgaaacttggattcatgtcgccattcgtgaaggcctgtgct
attgcacttcaggacgttcctattgtcaacgcatccttcggcactgactgcatcgaatac
cacgactacgtggacatcagtgttgccgtatccacaccgaaaggtcttgttgtgccggtc
cttcgtgacgtgcagaactccaactttgcccaaattgaaaagcaaatcgcagactttggt
gagcgcgcccgctcgaacaagctgaccatggcggagatgaccggtggcacattcactatt
agcaacggcggcgtgtttggctcgtggatggggacacctatcgtcaacccaccacagagc
gctattcttggtatgcacgccacgaagaagaagccgtgggttgtgggcaactccgtcgtc
ccgcgtgacataatggcggttgccctcacgtacgatcaccgtctcatcgacggcagtgac
gccgtaacatttctcgttaaggtgaagaacctcattgaggatcccgcacgtattgtgctc
gacctcgcctaa

DBGET integrated database retrieval system