KEGG   Trypanosoma brucei brucei: Tb11.01.7170
Entry
Tb11.01.7170      CDS       T01013                                 

Definition
(RefSeq) C-14 sterol reductase, putative
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
tbr  Trypanosoma brucei brucei
Pathway
tbr00100  Steroid biosynthesis
tbr01100  Metabolic pathways
tbr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tbr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    Tb11.01.7170
Enzymes [BR:tbr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     Tb11.01.7170
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT DUF5392
Other DBs
NCBI-GeneID: 3664443
NCBI-ProteinID: XP_829611
UniProt: Q381N2
Position
11
AA seq 458 aa
MPPRSRKGTKSRSASPAPRTPGRTKKSPVTPRTKTPVTNKNRSYEWGGPLGALGMVVLLP
LTVIGLNVLCSENSCSVHNVWDLPAMILLALDVGVPRLVLALGVELLWMAFHALLYITPV
GKQVKGVKLSDGTCLTYNINALHVFTLVHAILGSMHYADVIRLAWLADMFMPLMVAAIII
SVFMSIVLYVASFRSSQVSFSPGGNTGNYLYDFWVGRELNPRTGSLDWKFMCELRPGLIG
WSVLNWAFVAKAMEVGTCSPSIIVVALLESFYVLDGLLYEEGNLTMMDIVHDGFGFMLCF
GDLAWVPFTYTLKAKFLAYHASQLSYMHVGICAAVALVGYAVFRGSNNQKSRFRQNPKDP
ANAALKVMHTSSGKSLIVSGYWGVCRHPNYVGDWLMTLSWSALTGFTEPLPYFQPVYFAL
LLIHRQLRDEEQMREKYGAEDMHKFHRIVRYRLIPYVY
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgccgccacggagccgcaagggtacaaaatctcgctccgcatcgcctgcacctcggacg
cccgggaggactaaaaagagtcccgtcactcccagaactaaaacaccagtgacgaataaa
aaccgctcctacgagtggggaggccctctgggagcacttgggatggtggtgcttctgccg
ctcacagttattggtctcaatgtcttgtgctcagaaaattcgtgtagtgtgcataatgta
tgggaccttcccgcaatgatattgttggcattggatgtgggagtgccgcgattggtactg
gcacttggtgtcgagttgttgtggatggcatttcatgcacttctttacattactccggtt
ggaaagcaagtgaagggtgtgaaactctctgatggaacatgtctcacgtacaatatcaac
gcgttgcatgtgttcacacttgtacatgctattttgggtagtatgcactacgctgatgtg
attcgtctagcctggctggctgacatgtttatgccactcatggtggctgccatcatcatt
tctgtttttatgagcatcgtgctatacgtcgcttccttccgctcttctcaggtgtcgttt
tcccccggaggaaacactggaaactacttatacgatttctgggttggccgtgagctcaat
ccacgtacgggttcgcttgactggaagtttatgtgtgaactgcgtcccggtctcattggt
tggagcgtcctgaattgggcatttgtggcaaaagcgatggaggtcggtacatgctcgccc
agcattattgtggttgccctgctagagtctttctatgtgttggacgggcttctttatgaa
gagggaaacctcaccatgatggacatcgtgcatgatggttttgggtttatgctgtgcttc
ggcgatttggcgtgggtacctttcacttatacactgaaagcaaagttcctggcttatcat
gcctcgcagctgagctacatgcacgtaggcatttgcgctgcggtggcgcttgttggctac
gctgtgtttcgtggctcaaacaatcaaaaaagtcgttttcgacaaaatccaaaagatcca
gcgaatgcggcgctgaaggttatgcatacgtccagcggcaaatcgctgattgtgtcgggc
tactggggcgtgtgccgccatccgaattatgtaggggattggcttatgaccctttcatgg
tcagcacttacggggtttacggaaccactgccatactttcagccagtgtattttgctctg
cttttgattcaccgccaattgagggacgaagagcagatgcgtgaaaagtatggtgcagaa
gatatgcacaaattccatagaatagttcgttatcgcttgatcccatacgtctattag

DBGET integrated database retrieval system