KEGG   Trypanosoma brucei: Tb11.01.7560Help
Entry
Tb11.01.7560      CDS       T01013                                 

Definition
(RefSeq) glutathione peroxidase, putative
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
tbr  Trypanosoma brucei
Pathway
tbr00480  Glutathione metabolism
tbr00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Tb11.01.7560
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Tb11.01.7560
Enzymes [BR:tbr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Tb11.01.7560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 3664482
NCBI-ProteinID: XP_829649
UniProt: Q381J4
Position
11
AA seq 156 aa AA seqDB search
MNGGAIFSHSVLMDGNAVMLSKYAGCVTVLVNTASLCSFTSSNIQHLIHVQQKWASRSFT
VLAFPCSQFGNQEPKKRDEICCWVARNGINFPVFDKVNLKGPNTHPLFQMIQSSLGPIRW
NYTKVVCNRAGLPCVKLQPGSSLEELERYVSQLCDE
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcggcgccattttttctcactcggttctaatggacggtaacgcagtgatgctg
tccaagtatgctggttgtgtaacggttcttgttaacactgcgtccctctgctcttttaca
tcttcaaacattcaacaccttatacacgttcagcaaaaatgggcctcacgaagtttcact
gtcttagcctttccgtgctctcaatttggaaatcaagagccgaagaagagggatgagatt
tgctgttgggtggctcgtaatggaattaactttcctgtgtttgataaagttaacctgaag
gggccgaatacacaccctctgtttcaaatgattcagtcgtcacttggacctatacggtgg
aattacaccaaggttgtgtgcaatcgtgccggactcccatgcgtgaagcttcagccagga
agctcgctggaggaacttgagcgctatgtttcacagttgtgcgatgagtga

DBGET integrated database retrieval system