KEGG   Trypanosoma brucei: Tb11.47.0018Help
Entry
Tb11.47.0018      CDS       T01013                                 

Definition
(RefSeq) NADH-cytochrome b5 reductase, putative
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tbr  Trypanosoma brucei
Pathway
tbr00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Tb11.47.0018
Enzymes [BR:tbr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     Tb11.47.0018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 3664333
NCBI-ProteinID: XP_828222
UniProt: Q387C1
Position
11
AA seq 325 aa AA seqDB search
MRFVPPFLAGAALATYYRPLDKSKSAYCYASIENALHFQPKPKPGKVFSQRYQPYTLGDV
VPITHDTALFRFLIDGNEEFNLKPCSTLQACYKYGVQPMDQCQRFYTPVTANHTKGYFDI
IVKRKQGGLMTEHLFGMHIGDKLLFRSVTFKLQYRPNRWKHVGMIAGGTGFTPMLQIIRH
SLQEEWDNGMVDRTKLSFLFCNRTERHILLKGLFDDLAQKYSNRFKVYYTIDQAVEPDVW
PHYTGLVTKEMVHETMPAPNEEKKIILLCGPDQLLNHVAGTPMGTMNTMSSGMNIQPMAP
DLNNLVNLGGILGELGYSNDEVYRF
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcgctttgttccacctttccttgcgggtgcagcactcgcaacttactaccgacctctg
gacaagtcgaaatctgcatattgctacgcgagtattgaaaatgccttacactttcaacct
aaaccaaagcccggaaaagttttttcccaacgataccaaccgtatacccttggggatgtt
gttccgataacacatgacactgctctttttcgtttccttattgatggaaatgaagagttt
aacctaaagccatgctccacactacaggcatgctacaaatatggcgtgcaacctatggat
caatgccagcgcttctacactcctgtgacggctaatcacacgaaaggttatttcgatatt
attgtgaagcgcaagcaagggggactcatgacagagcatttatttggtatgcacatagga
gataaacttctgtttcgatcagtcacattcaaactgcagtatcgtccgaataggtggaaa
cacgtgggaatgatagcgggtggcactgggttcactccaatgttgcaaatcatccgtcat
tcgctccaggaagaatgggacaacggtatggttgatcggactaaattatcttttcttttc
tgtaaccgaacggagagacacattttgttgaagggactctttgatgatctcgcacaaaag
tattccaatcgttttaaggtatattacacaattgatcaggctgtcgagcctgacgtatgg
ccgcactacaccggactcgtaacaaaagagatggtgcatgagaccatgccggcaccgaat
gaggaaaaaaagattatattattgtgtggtcccgatcagctgttgaatcatgtcgctgga
acaccaatgggaacaatgaacaccatgtcgagtggaatgaatatccaaccgatggcacca
gacctcaataatttagtaaatcttggggggatattaggggaactcgggtactccaatgat
gaagtttatcgcttctaa

DBGET integrated database retrieval system