KEGG   Trypanosoma brucei: Tb927.3.3270Help
Entry
Tb927.3.3270      CDS       T01013                                 

Definition
(RefSeq) ATP-dependent phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tbr  Trypanosoma brucei
Pathway
tbr00010  Glycolysis / Gluconeogenesis
tbr00030  Pentose phosphate pathway
tbr00051  Fructose and mannose metabolism
tbr00052  Galactose metabolism
tbr01100  Metabolic pathways
tbr01110  Biosynthesis of secondary metabolites
tbr01130  Biosynthesis of antibiotics
tbr01200  Carbon metabolism
tbr01230  Biosynthesis of amino acids
tbr03018  RNA degradation
Module
tbr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tb927.3.3270
   00030 Pentose phosphate pathway
    Tb927.3.3270
   00051 Fructose and mannose metabolism
    Tb927.3.3270
   00052 Galactose metabolism
    Tb927.3.3270
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Tb927.3.3270
Enzymes [BR:tbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tb927.3.3270
Protein phosphatases and associated proteins [BR:tbr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Tb927.3.3270
Messenger RNA biogenesis [BR:tbr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Tb927.3.3270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-GeneID: 3656265
NCBI-ProteinID: XP_843920
UniProt: D6XDN4
Structure
PDB: 

Position
3
AA seq 487 aa AA seqDB search
MAVESRSRVTSKLVKAHRAMLNSVTQEDLKVDRLPGADYPNPSKKYSSRTEFRDKTDYIM
YNPRPRDEPSSENPVSVSPLLCELAAARSRIHFNPTETTIGIVTCGGICPGLNDVIRSIT
LTGINVYNVKRVIGFRFGYWGLSKKGSQTAIELHRGRVTNIHHYGGTILGSSRGPQDPKE
MVDTLERLGVNILFTVGGDGTQRGALVISQEAKRRGVDISVFGVPKTIDNDLSFSHRTFG
FQTAVEKAVQAIRAAYAEAVSANYGVGVVKLMGRDSGFIAAQAAVASAQANICLVPENPI
SEQEVMSLLERRFCHSRSCVIIVAEGFGQDWGRGSGGYDASGNKKLIDIGVILTEKVKAF
LKANKSRYPDSTVKYIDPSYMIRACPPSANDALFCATLATLAVHEAMAGATGCIIAMRHN
NYILVPIKVATSVRRVLDLRGQLWRQVREITVDLGSDVRLARKLEIRRELEAINRNRDRL
HEELAKL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggccgttgaatctcgcagccgcgttacgagcaagctcgtcaaggcccaccgcgccatg
ctgaacagcgtgactcaggaggacctcaaggtggaccgcctccccggtgcggattacccg
aacccgtccaaaaaatattcgtcgcgcacagagttccgtgacaagacggattacatcatg
tacaacccccgccccagggatgaaccctcttcggagaaccctgtatcggtgagcccactc
ctttgcgaacttgctgctgcccgctcgcgcattcacttcaacccgacggagaccaccatt
ggtattgtcacgtgcggtggtatttgccccggcctcaacgacgtcatccgttccatcacc
cttaccggcatcaacgtgtacaacgtaaagcgcgtgattggcttccgcttcggatactgg
ggcctttccaagaagggcagtcagacggccattgaactccaccgcggaagagtcaccaac
atccaccactatggcggcaccatcctaggcagcagccgtggtccgcaggaccccaaggag
atggttgatactctcgagcgcctcggtgtcaacatcctcttcaccgtcggtggtgacggc
acgcagcgcggtgcgctcgtcatctctcaagaagccaagcgccggggtgttgacatctcc
gtttttggtgttcccaagactattgacaacgacctcagcttctctcaccgcacgttcggc
ttccagactgctgttgagaaggctgtgcaggccatccgcgcggcgtatgctgaggctgtc
tccgccaactatggtgttggcgttgtgaagctcatgggtcgtgacagcggcttcattgcc
gctcaggctgcagtggccagtgcgcaggcgaatatctgccttgttcctgaaaaccccatc
tccgagcaggaggtgatgtcccttctggagcgccgattctgccattcccgttcctgcgtc
atcatcgtcgctgagggattcgggcaagactggggccgcggctctggtggttatgacgcg
tctggcaacaagaagctgattgacatcggcgttatcctcacggagaaagtgaaggctttc
ctcaaggcaaacaagtctcgctaccctgactcgacagttaaatacattgacccctcgtac
atgattcgtgcttgcccaccgtcggccaatgacgccctcttctgcgccacccttgccact
cttgcggtacatgaggcaatggctggtgccacgggctgcattattgccatgcggcacaac
aactatattcttgtgcccatcaaggtggccacttccgtccgccgtgtgctcgacctccgc
ggacagctgtggcgtcaggtgcgtgaaatcacagtggatctgggcagcgacgtccgcctg
gctcgtaaattggagatccgccgtgaactggaggcaatcaacaggaatcgcgaccgcctc
cacgaggaactggccaagctctaa

DBGET integrated database retrieval system