KEGG   Trypanosoma brucei: Tb927.4.1860Help
Entry
Tb927.4.1860      CDS       T01013                                 

Definition
(RefSeq) ribosomal protein S19, putative
  KO
K02966  small subunit ribosomal protein S19e
Organism
tbr  Trypanosoma brucei
Pathway
tbr03010  Ribosome
Module
tbr_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:tbr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Tb927.4.1860
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tbr03011]
    Tb927.4.1860
Ribosome [BR:tbr03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    Tb927.4.1860
  Archaea
    Tb927.4.1860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S19e Mrr_N
Motif
Other DBs
NCBI-GeneID: 3656713
NCBI-ProteinID: XP_844336
UniProt: Q583K7
Position
4
AA seq 167 aa AA seqDB search
MAVARTKANSKIRRIGKKKGATLRDVHPWRWVKICSQHFKQEGKMMVPNCAEIVKTSHGR
ERAPQNPDWYYIRCAAVLRAVYLRPGVGYGGLSKRFSSKKNRGSRPEITTRASKGLLHWC
CKSLTKLELLEKCKGAGHRVTKLGRKVADTIAFKIALRKMGAETKAK
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgctcgcacaaaggctaattccaagatccgccgcatcggaaagaagaagggc
gcgactctgcgtgatgttcacccatggcgctgggtgaagatctgcagccaacatttcaag
caggagggtaaaatgatggtaccaaactgtgcagaaattgtcaagacttcacacggccgc
gagcgcgccccgcagaatcccgactggtattacatccgttgcgccgctgtgctccgtgcg
gtgtacctgcgccctggtgtgggatatggtggcctcagtaagcgcttctccagcaagaaa
aaccgcggaagccgtcctgagattacaactcgcgcttcaaaaggtctccttcactggtgt
tgcaagagccttaccaagttggaattgcttgagaaatgcaagggagctggacatcgtgtt
actaaactcggtcgcaaggtggcagacaccattgccttcaagattgccctccgcaagatg
ggcgctgagacaaaggcaaagtaa

DBGET integrated database retrieval system