KEGG   Trypanosoma brucei: Tb927.4.2450Help
Entry
Tb927.4.2450      CDS       T01013                                 

Definition
(RefSeq) thioredoxin, putative
  KO
K01829  protein disulfide-isomerase [EC:5.3.4.1]
Organism
tbr  Trypanosoma brucei
Brite
Enzymes [BR:tbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Tb927.4.2450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_2 Thioredoxin_8 Thioredoxin_6 Thioredoxin_7 Redoxin OST3_OST6 Thioredoxin_9
Motif
Other DBs
NCBI-GeneID: 3656771
NCBI-ProteinID: XP_844395
UniProt: Q584E2
Position
4
AA seq 411 aa AA seqDB search
MKRPSFLLVSLLFLAIGSTVIEAFPFTASSGVVELTPATFNSFLGSHKPVFILFYAPWCG
HCKRLHPEWEKFAKSVEGIVRVGAVNADEHQQLGQQFNLRGFPTVKFWGLGEKRANAAMD
YAGERSAGAIQSQAISLINAPGIKTVKKAEELREAAQAAPEKKAVVLFSAKSRVPPIYAV
LSLSPRLKSMPFYFAGEQEKSGFASEFGVSKLPAIVVLNTTAGEVKPVIYPGKKVAYEPI
AKFLLACANDAYDEANFSLEGGESEQATKKGAAKLALPVRPLPASAHGLENFCSPDARKK
AERTPLCVISLTSEFSLNDVHKTFSNEPLVFFEAGDARDILLGALRGKLGLEKIADKLKD
DKEHNALLLRASKQGTVHYRLVGGVNTAETLSSVLQMVVSGEISLTKEQPK
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcccttcttttcttcttgtgagccttttgtttttggcaattggcagcactgtc
atagaagccttccccttcacagcctcctctggtgttgtggagctaacccctgcgactttc
aacagcttcctcggctctcacaaacccgtttttatccttttctacgcaccgtggtgtggg
cactgcaagcgccttcacccggagtgggaaaagtttgccaaatctgtcgagggaattgtt
cgtgtgggtgctgtgaatgccgatgagcaccagcaacttggccaacaattcaacctgcgc
ggtttccctacggttaagttttggggtttgggagaaaagcgtgccaatgcagctatggac
tacgccggtgagcgcagcgcgggagccattcaatcgcaagccatcagtctcatcaatgca
ccaggaatcaagacggtgaaaaaagctgaggagctacgcgaggcggctcaggcggcacca
gagaagaaggctgttgtactattcagtgctaaaagccgcgtgccgccaatttatgccgtt
ctttcgctctcaccccgactcaagtcgatgccgttttactttgcaggggagcaagaaaag
tctggattcgcttcagaatttggcgtaagtaaacttccagccattgttgtcctcaacacc
accgctggcgaagtgaagccggtgatatacccggggaagaaagttgcttatgagcccatt
gcaaagtttttactggcctgtgcaaacgatgcttacgatgaggctaacttctccttggag
ggtggtgagagtgagcaagctacaaagaagggtgctgcaaagttggcgctgccagtccgg
ccgctccccgcgtcagctcatggtctcgagaatttttgctcccctgacgcacggaagaag
gctgagcgaacgccactgtgtgtgatttcactcacttctgagttttcgcttaacgacgtg
cataaaaccttcagcaatgagccacttgttttcttcgaggctggggatgctcgtgatatc
cttcttggggcccttcggggaaagctgggactagagaagattgcagacaaactgaaggac
gacaaggaacacaacgcacttctgcttcgcgcctccaagcagggcaccgtacactacaga
ctcgttggaggcgtaaacacagctgaaactctcagctcagtcttacaaatggttgtatca
ggcgagatatccctcacgaaggagcagccgaagtaa

DBGET integrated database retrieval system