KEGG   Trypanosoma brucei: Tb927.6.1400Help
Entry
Tb927.6.1400      CDS       T01013                                 

Definition
(RefSeq) cyclophilin-type peptidyl-prolyl cis-trans isomerase, putative
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
tbr  Trypanosoma brucei
Brite
KEGG Orthology (KO) [BR:tbr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Tb927.6.1400
Enzymes [BR:tbr01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     Tb927.6.1400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 3657777
NCBI-ProteinID: XP_845262
UniProt: Q585A7
Position
6
AA seq 260 aa AA seqDB search
MSTTKLEGVRHSRRKKGDSRLQRPENDEDSATLQSRYDDVEERRLKEWENYQRSHRMKEE
QNSCRAFLDMSIDDVLSGRLVFELFDDVVPRTVENFRALITGSCGIDTNTGVKLDYLGTQ
VHHVDHNNNIIVLGELDSFNLSSTGTPIADEGYRHRHTERGLLTMISEGPHTSGSVFGIT
LGPSPSLDFKQVVFGRAIDDLSLLEKLEAVPLDDVGRPVLPVTVSFCGALTGEKPPGRQQ
VPAAADDSASSEHVSCAGEE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgacaaaactagaaggtgtacggcactcccgcaggaaaaagggagattcgagg
ttacaacgaccagaaaatgatgaagactctgcgacacttcagagtcgttacgacgatgtg
gaggagcgccgtttaaaagaatgggaaaattaccagcggagtcatcgcatgaaggaggaa
cagaactcctgccgtgccttcctggatatgtccattgatgacgttctcagcggacgactg
gtatttgaactctttgacgatgtagtgccgcgaaccgtagaaaacttcagggcattaatc
actgggtcatgtgggattgacaccaacacgggtgtgaaattggattaccttggcacacaa
gtgcatcatgtggatcacaacaataatatcattgtgttgggtgaattggattcctttaac
ctctcctccactggcacaccaatagcggatgaaggataccgtcaccgacacacggaacgt
gggcttctcacaatgatctctgagggtcctcacacaagtggctccgtatttggcattaca
cttggtccttctccatctcttgatttcaagcaagttgtgtttggacgtgctattgatgat
ctctcactgctagagaaacttgaggcagttcctcttgatgatgtgggcagacccgttttg
ccagtaactgtaagcttctgtggtgcattgactggagagaaaccacctggaagacaacag
gtacctgctgcagcggatgacagtgcgtcaagtgaacatgtgagttgtgcaggagaggaa
tag

DBGET integrated database retrieval system