KEGG   Trypanosoma brucei: Tb927.6.560Help
Entry
Tb927.6.560       CDS       T01013                                 

Definition
(RefSeq) cysteine peptidase C (CPC)
  KO
K08572  cysteine peptidase C [EC:3.4.22.-]
Organism
tbr  Trypanosoma brucei
Brite
KEGG Orthology (KO) [BR:tbr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tbr01002]
    Tb927.6.560
Enzymes [BR:tbr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     Tb927.6.560
Peptidases and inhibitors [BR:tbr01002]
 Cysteine peptidases
  Family C1: papain family
   Tb927.6.560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Propeptide_C1 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 3657691
NCBI-ProteinID: XP_845179
UniProt: D6XHE1
Structure
PDB: 

Position
6
AA seq 340 aa AA seqDB search
MHLMRACITFCIASTAVVAVNAALVAEDAPVLSKAFVDRVNRLNRGIWKAKYDGVMQNIT
LREAKRLNGVIKKNNNASILPKRRFTEEEARAPLPSSFDSAEAWPNCPTIPQIADQSACG
SCWAVAAASAMSDRFCTMGGVQDVHISAGDLLACCSDCGDGCNGGDPDRAWAYFSSTGLV
SDYCQPYPFPHCSHHSKSKNGYPPCSQFNFDTPKCNYTCDDPTIPVVNYRSWTSYALQGE
DDYMRELFFRGPFEVAFDVYEDFIAYNSGVYHHVSGQYLGGHAVRLVGWGTSNGVPYWKI
ANSWNTEWGMDGYFLIRRGSSECGIEDGGSAGIPLAPNTA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcatgcgtgcctgcatcacattttgtatcgcttcgacggctgtagtcgccgta
aacgccgccctcgttgctgaagacgcgcccgtcctctccaaggctttcgtcgaccgcgtg
aaccgcctcaaccgcgggatttggaaggcgaagtacgatggcgtcatgcaaaacataaca
ttgcgcgaggcgaagcggctcaacggtgttattaaaaagaataataacgccagcatcctt
ccgaagaggcgattcaccgaggaagaggcacgtgccccgcttcccagcagcttcgattcc
gctgaagcttggcccaactgccccaccatcccacaaattgcagatcagtccgcctgtggc
tcctgctgggcagtcgctgcggcctcagccatgtccgaccgattttgtacgatggggggt
gtgcaggacgtccatatctcagcaggtgacttgcttgcgtgctgcagtgattgtggcgat
ggctgtaatggtggcgatccggatagggcgtgggcgtactttagctcaacaggcctcgtt
tcggactactgccaaccctacccatttccccattgctcacaccacagcaaaagcaaaaat
gggtaccctccctgttctcagttcaactttgacacgcccaagtgcaattacacgtgcgat
gacccgacaatccccgttgtcaactaccgttcctggacgagctatgcgcttcaaggagag
gatgactacatgcgtgagttgttcttccgcggtccatttgaggtggcgtttgatgtctac
gaagacttcatcgcctacaacagcggcgtctaccaccacgtttcaggacaatatctcgga
ggacatgcggtgaggctcgttgggtggggcacatcaaacggagtgccgtactggaagatt
gccaacagctggaacaccgagtggggaatggacggttactttctcatccgccgcggaagt
agcgaatgcggcatcgaggatggcggttctgctggcattcctcttgcacccaacacggcg
tag

DBGET integrated database retrieval system