KEGG   Trypanosoma brucei: Tb927.7.1300Help
Entry
Tb927.7.1300      CDS       T01013                                 

Definition
(RefSeq) protein disulfide isomerase, putative
  KO
K09584  protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
tbr  Trypanosoma brucei
Pathway
tbr04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Tb927.7.1300
Enzymes [BR:tbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Tb927.7.1300
Chaperones and folding catalysts [BR:tbr03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Tb927.7.1300
Membrane trafficking [BR:tbr04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    Tb927.7.1300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin OST3_OST6 ERp29 Thioredoxin_2 Thioredoxin_7 ERp29_N Thioredoxin_8 AhpC-TSA Redoxin Thioredoxin_6 HyaE Thioredoxin_9 TraF Glutaredoxin Acetyltransf_15
Motif
Other DBs
NCBI-GeneID: 3658342
NCBI-ProteinID: XP_845754
UniProt: Q57WS0
Position
7
AA seq 377 aa AA seqDB search
MTPFSCRKTSLLKAICIFAYFASAAHANEPDAALEGVVDLTSNNFDSSVGKDVAALVEFY
APWCGHCKNLVPEFAKLGRAAAGAKDKVLIAKVDATAQKDLATRFEVNGYPTILFFPAGS
QKPEKYSEGREAKAFVSYLNNQIKGLNLFLPREHKYVMALDQSNFDKVALDEGKDAFVLF
YAPWCGHCKRLHPSFESLAKVYQNEKDLIIANVDADDKSNSEVTKRYKVEGYPTLVFFPK
GNKGNPVNYEEGRTLDDMIKFVNERTGKKRTSSGDFDKTVGVDETVTNLMKEMAQSSKNK
EERERLLAQIQQAVSPKALGEGAMHYIRIATNVLENGHEYISKEHERVGRLLKGSLTGPK
RDSLTIRFNILSAIKGE
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgttttcatgtcgcaaaaccagcctgttgaaagccatttgcatctttgcttat
tttgcatctgcagcgcatgctaacgaaccggatgcggcgctggagggtgttgtagacctc
accagcaataactttgacagtagtgtgggaaaggacgtggcagcgctggtggagttttac
gcgccatggtgtggacactgcaaaaacctcgtaccggagtttgccaaactcggccgcgcc
gccgctggggccaaggataaagttctcattgctaaagtggatgccacagcccaaaaggac
ctcgcaactcgctttgaggtgaatgggtacccaaccattctcttctttcctgctggctcg
cagaagccggagaaatacagcgagggtcgcgaggcgaaggcgtttgtttcgtaccttaac
aaccaaataaagggcttgaacctttttcttccccgtgaacacaagtacgtgatggcgctg
gaccaatccaactttgacaaagtggcactggacgaagggaaagatgcgtttgttttattt
tacgccccctggtgtggacactgcaagcgcctccatccctcgtttgagagtctcgcgaag
gtgtaccaaaacgaaaaggacctcatcattgctaatgtcgacgctgatgacaagagcaac
tctgaggtgacgaagcgctataaggtggagggctaccccactctcgttttctttccaaaa
ggaaataagggcaacccggtgaactatgaggagggacgaaccttggacgatatgatcaag
ttcgtcaatgagagaacggggaaaaaacgcaccagcagcggtgattttgacaaaactgtt
ggtgtcgatgaaaccgtcacgaacctcatgaaggagatggcacagtcaagcaagaacaag
gaggagagggaacgcctcctcgcgcagattcagcaagccgtctcccccaaagctctaggc
gagggtgccatgcactacatccgtattgctactaatgtccttgagaatggtcatgagtat
attagcaaggaacacgagcgtgtcggccgtcttctgaagggaagtctgacaggtccgaag
agggattcgttgacgatccgattcaacattctttcggcaatcaaaggtgagtaa

DBGET integrated database retrieval system