KEGG   Trypanosoma brucei: Tb927.7.6310Help
Entry
Tb927.7.6310      CDS       T01013                                 

Definition
(RefSeq) polo-like protein kinase
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
tbr  Trypanosoma brucei
Brite
KEGG Orthology (KO) [BR:tbr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tbr01001]
    Tb927.7.6310
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tbr03036]
    Tb927.7.6310
Enzymes [BR:tbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     Tb927.7.6310
Protein kinases [BR:tbr01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   Tb927.7.6310
Chromosome and associated proteins [BR:tbr03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     Tb927.7.6310
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Tb927.7.6310
  Sister chromatid separation proteins
   Polo kinases
    Tb927.7.6310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr POLO_box Kinase-like Pkinase_fungal Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 3658841
NCBI-ProteinID: XP_846254
UniProt: Q57VI0
Position
7
AA seq 768 aa AA seqDB search
MHATAETCETPSSSRRPPNDRPDFREGSTLKEFDKSGRLVGYFRCGRMLGRGGFAKCYEV
EQGGDTYALKVVDRSLLQKTKTLQKLHSEISIHRRMKHKHIVNFIRTFHDDWNVYILLEK
CSNQTLMEILKRRQRFSVPETQYIALQSLSAIQYMHEQCVIHRDLKLGNIMMDANMNVKI
GDFGLAAELQYDGERKRTICGTPNYIAPEIIEGSREGHSYEVDVWSLGVILYTLLVGEPP
FQTSDVKATYRRIRQCRYEFPSHVDVPESGKELIHSILQSRPDQRPTLLEIRSHPFFRLP
PPPTTAPTTLFYSSRRRQHSDDPRGHAQGPLPLRRQKSGDIQAALQKQTPQRRQPQSQPK
SVEAVRCISSPRVSREVLQPISTNLPKTDRYHLKPSCPAVASARFHGALGGDCNNNNNNN
NNNINNNNNNNINSAAVSIPSPRADAIRPLTQVAAPGGADESAETTATTPRVQLRPHPAI
EEEEKNELTAVHDQLHQTLREIGDISPREVATRTQTKRSPQVAPLPVPNSPTTSTVPALT
PRCEDEPAPSLPLPTVWVTSFADFSEKYGLCYRLSTGHTGVHFNDSTKMVWEPITNRVEY
YMRVKEVVARGNANVLQARDQQHAFHMDMFPESLTKKVTLIKYFKSYLSRTRNSHTNVEV
VRCSPYVSEVTPSLSGPHMIEDIVYVKRWLITPQAIIFRLSNKTIQVCFHDKAEVILSSE
SRVVTYTEPTGNRVTMSLSSVATRSREIAARLRYTKDILSELIQNRDI
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcaaccgctgagacgtgtgaaacgccgtcgagttcgcggcgccctccaaatgac
aggccggactttcgtgagggttcaactcttaaggagtttgataaaagtggccgtctcgtg
ggatatttccgttgcggaaggatgctcgggcgtggtggctttgcaaagtgttatgaagtg
gagcagggtggcgatacgtatgcgttgaaggttgtggaccgctcactactgcagaaaact
aagacactacagaaactccactctgagatatccattcaccgccgcatgaagcacaaacac
attgttaacttcatacggaccttccatgacgactggaatgtttatattctgttggagaag
tgcagcaatcagacgctgatggaaatattgaagcgccggcaacgtttcagtgtgccagag
acacaatacattgcattgcagtcgctttccgccattcaatatatgcatgagcaatgtgtt
attcatcgtgacctgaaacttggtaacataatgatggatgcaaatatgaacgtgaagatt
ggggacttcggtttggctgctgagttgcagtacgacggggagcggaaacgcactatttgt
ggcacgcccaattatatcgcaccggagatcattgaaggttcgcgcgagggacatagttac
gaagtggatgtgtggtcgctcggtgtgatcctctacacgctgttggttggagagccgccg
tttcagacatcagatgtgaaggccacttaccgtcgtattaggcaatgccggtatgaattt
ccttcacatgtagatgtgccagagagtgggaaggaacttattcacagtattctgcagagc
cgccccgaccaacggccgacgttgctggaaattcgttcacatccatttttccgcctcccg
ccgccaccgacgacagcacctaccacactcttctacagttcacgccgccgtcagcattcg
gatgacccccgaggacatgcgcagggaccacttccacttcgccgccaaaaatcaggggac
attcaggcggcgttgcagaaacaaacaccgcaacgccgtcaaccgcagtcgcagcccaaa
tcagttgaagctgttcgctgcatttcgagtccgcgtgtgtcccgcgaagtgcttcaacct
atcagcacaaatctacccaaaacggaccgataccacctaaaacccagctgcccggcggta
gcttccgcaaggtttcatggggctttgggcggtgactgcaacaacaacaacaacaacaat
aacaataacatcaacaacaacaacaacaacaacattaacagtgctgcggtgagcatcccg
tcacctcgtgcagatgcgattcgacccctcacgcaagttgccgcaccgggcggtgctgat
gaatccgcggaaaccactgcaacaactccgcgtgtgcagctgagacctcacccagctata
gaggaagaggagaagaatgaactcaccgccgtgcatgatcaacttcatcagacgttacgg
gaaataggcgacatttccccacgtgaggttgccacccgcacacaaaccaaacggtcaccg
caagtggctcccttgccagtgccgaactcacccacaacatctacagttcctgcattaacg
cccagatgcgaagacgagccggcgccatcgttgccacttcccactgtttgggtgacgagt
ttcgcggatttctccgaaaaatacgggttgtgttaccggttgagcaccggccataccggt
gtgcacttcaacgactccactaaaatggtgtgggagcccattacaaaccgtgtagagtat
tatatgcgagtgaaggaagttgttgcgcgtggtaatgccaacgtcctgcaggcgcgagat
caacaacatgcgtttcacatggatatgttccctgaaagcctgaccaagaaggtgacattg
atcaaatactttaaatcatacctctcacgaacgcgtaattctcataccaacgtggaggtt
gtacggtgctcaccatatgtgtccgaagttactccgtcacttagcggaccgcacatgatt
gaagatattgtatatgtcaagcgctggttgatcacaccacaagcaattatattccgtcta
tccaacaaaactattcaggtttgttttcatgataaggcggaagttattctaagttcggag
tcgcgtgttgttacatatacagaaccaactggcaaccgcgtgacaatgtcgctatcgtct
gttgcgacacgctctagagaaattgctgcacggcttcgttacaccaaagacatcctcagc
gagctcatacaaaaccgtgatatttag

DBGET integrated database retrieval system