KEGG   Tenericutes bacterium MZ-XQ: BK011_05580
Entry
BK011_05580       CDS       T05490                                 

Definition
(GenBank) LuxR family transcriptional regulator
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
tbz  Tenericutes bacterium MZ-XQ
Pathway
tbz00472  D-Arginine and D-ornithine metabolism
tbz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    BK011_05580
Enzymes [BR:tbz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     BK011_05580
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: AUD65177
UniProt: A0A2K9AND9
Position
complement(1140196..1142391)
AA seq 731 aa
MLKPNEKLDIKNILSDLENYRPKRKGWVWREHKPQNIGPFFYQDVSDSLKNYVSLPSARH
LNHIDPQPQSTITTEIASGRFEDDIRRMRMAAYHGADHMMVIRTAGQSHMDGLLEGTPQG
VGGVPITRKQVRAQRKALDIIEEEVGRPINYHSYVSGVAGPEIAVMFTEEGVNGAHQDPQ
YNVLYRNINMIRSFVDAAESKKIMAFGELAQIDGAHNANATARDAWKVMPELLVQHGINS
RFSERVGIKPDLICLSTVPPAAPPSPDIKLNLPYALALREFFSNYKMRAQMNTKYMDSST
REATVTHVLNLLISKLTSADIQSTITPDEGRNVPWHMFNIEALDTAKQAMIGMDDLMSML
TFKTDGELFKTKRELEERAILMMEEIIELGGYFKAVEAGMFVDSGLYPERMGDGIKREVN
GGIGSDTTYKRAKDYMAPVSAHYGFNNIEQYGISKHPESLINGSTFEKPEKIQFIDELDE
EDNVNIRMDQTKNYRDTHLIKPEVQWLGDGVVTVDLFFPTDKDTAEAAALEVGKKMNLTN
VEVIHVEVLHPSEGTRVQFKGVFDIDIDINELKILKKEENLPEEEILAYVKKHDLKIVAG
TGGNDEHSVGMREILDIKHGGIEKYGIHYTYLGTSVPIEKFIDAAIEIDASCVMISLIIS
HDDIHYKNMQKLNDYAIEKGVRDKLILIAGGTQVTPELAKSYGMDQGFGRGTKGIDVASF
IVKQHKKIYES
NT seq 2196 nt   +upstreamnt  +downstreamnt
atgctaaagcctaatgaaaaacttgatataaaaaacatactaagtgatttagaaaattat
agacccaaaagaaaaggttgggtatggagagaacacaaacctcaaaacataggacctttt
ttctatcaagatgtcagtgattcactaaaaaattatgtatcgttaccaagtgcaagacat
ttaaatcatattgatccacaacctcaatcaacgattacaacagaaattgcttcaggtagg
ttcgaagatgatattagacgtatgcgtatggctgcttatcatggtgctgatcatatgatg
gtcattagaactgctggacaatcacatatggacggacttcttgaaggtactcctcaaggg
gttggtggagttcctatcactagaaaacaagttagagctcaaagaaaagctttagatatc
attgaagaagaagtcggtagaccgattaattatcattcatatgtatcaggagttgctggt
cctgaaatcgcagtcatgtttactgaagaaggtgtcaatggtgcacatcaagacccacaa
tataatgtgttatatcgcaacattaacatgattagaagttttgtggatgcagcagaatct
aaaaaaattatggcttttggagaacttgcacaaatcgatggtgcacataatgcaaatgca
acagctagagatgcttggaaagtgatgcctgaacttcttgtgcaacatggtattaattca
agatttagcgaacgtgtagggatcaaaccagatttgatttgtctatcaacggttccacca
gctgcaccaccaagtccagacattaaacttaatctaccttatgcacttgcactgcgtgag
ttttttagcaattataaaatgcgtgcacaaatgaatacaaaatatatggattcgtcaaca
agagaagctacagtgacacatgtcttaaatctattgatttctaaactaacttctgcagat
atacaatcaacgattactcctgatgaaggacgtaatgtgccgtggcatatgtttaacatt
gaagctttagatactgctaagcaagccatgattggtatggacgatttaatgagcatgtta
acatttaaaacagatggagaactttttaaaactaaacgtgaactagaagaacgagcaatt
ttaatgatggaagaaatcatcgaattaggtggttatttcaaagctgttgaggctggtatg
tttgtcgatagtggactatatccagaacgcatgggtgacggtattaaacgagaagttaat
ggtggtattggtagtgatacaacatataaacgtgctaaggactatatggctccagtgtca
gctcattatggattcaataatatcgagcaatacggtataagcaaacatccagaatcatta
atcaatggatcaacttttgagaaacctgaaaaaatccagtttattgacgaacttgatgaa
gaagataatgtgaatatccgcatggatcaaacaaaaaattatagagacactcatcttata
aaaccagaagttcagtggttgggtgatggtgtggtaacagttgatttattttttccaaca
gataaagatactgccgaggcagcggctttagaagtaggtaaaaaaatgaatttaaccaat
gtggaagttatacatgtcgaagttcttcatcctagtgaaggtacgagagttcaattcaaa
ggtgtctttgatattgatattgacatcaatgaattaaaaattctcaaaaaagaagaaaat
ttaccagaggaagaaatcttggcttatgtaaaaaagcatgatttaaaaattgttgctggc
acaggtggaaatgatgaacacagtgttggtatgagagaaatcttggatatcaaacatggt
ggtattgaaaaatatggcattcattatacatacttaggcacaagtgttccaatcgaaaaa
tttattgatgcggctattgaaatcgatgcaagttgtgtcatgatttcactcatcatctca
catgatgatattcactacaagaatatgcaaaaattaaatgattatgcgattgaaaaaggt
gttagagataaattgatattaatcgctggtggtacacaagtgactccagaactcgcaaaa
tcatatggcatggatcaaggttttggtagaggtacgaaaggaattgatgttgcttctttc
attgtgaaacaacacaaaaagatttatgaaagttga

DBGET integrated database retrieval system