KEGG   Tenericutes bacterium MZ-XQ: BK011_05585
Entry
BK011_05585       CDS       T05490                                 

Definition
(GenBank) ornithine aminomutase
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
tbz  Tenericutes bacterium MZ-XQ
Pathway
tbz00472  D-Arginine and D-ornithine metabolism
tbz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    BK011_05585
Enzymes [BR:tbz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     BK011_05585
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A
Other DBs
NCBI-ProteinID: AUD65178
UniProt: A0A2K9AGD0
Position
complement(1142378..1142746)
AA seq 122 aa
MKARKDDFEQRRKHLKDMSDQDLKTYFYKLLDEMIDPILDLAYTHTSPSIERSVLLRMGF
SSIEAKAIVDLILENNLIEHGAGHVVYKYAQKHQLNMREAGLKLLETHNLDDIKEDFKHA
KA
NT seq 369 nt   +upstreamnt  +downstreamnt
atgaaagctagaaaagatgattttgaacaaagacgaaaacacctaaaagacatgtcggat
caagacttgaaaacttatttttataaattattagatgaaatgattgatccaattttagat
ttagcttatacacacacatcaccttcaattgaacgaagcgtactacttcgtatgggattt
tcttcgattgaagcaaaagcaatcgtcgatttgattttggagaataatttaattgaacat
ggtgctggacatgttgtttataagtatgcccaaaaacatcaactaaatatgagagaagct
gggttgaaactacttgaaacacataatctagatgatatcaaggaggattttaaacatgct
aaagcctaa

DBGET integrated database retrieval system