KEGG   Tenericutes bacterium MZ-XQ: BK011_06430Help
Entry
BK011_06430       CDS       T05490                                 

Definition
(GenBank) hypothetical protein
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
tbz  Tenericutes bacterium MZ-XQ
Pathway
tbz00511  Other glycan degradation
tbz00600  Sphingolipid metabolism
tbz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    BK011_06430
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BK011_06430
Enzymes [BR:tbz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BK011_06430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59 Glyco_hydr_30_2 Cyc-maltodext_C
Motif
Other DBs
NCBI-ProteinID: AUD65340
UniProt: A0A2K9AD43
Position
complement(1313716..1315020)
Genome map
AA seq 434 aa AA seqDB search
MRHIRTSNRDNERLDEIIVDEIFPLEKATISVDPNQKMQEIIGFGGAFTEASAYNLLRVN
KEERQKAINAYFDPVDGLGYSIGRVSIHGCDFSLNSYLYIDDYDDTLESFSIKRDQPIID
LIKEASEVRGQNIKILASPWTPPFWMKDNNSPIKGGKLLPKYDDIWAKYFVKFIRAYEKA
GIDVFSVTVQNEPMAVQRWDSCIYEAEDEARFVKVLGKTFEKEKLDQKIYIWDHNRDLML
ERTKKVLSDPEAYKYVYGTAFHWYDNELFDEVKKTHDAFPDKHLLFTEGCQENGPHPSDY
AVGERYGRNIIHDLRNYNEGYIDWNLFLDDTGGPNHVNNLCSSPIIVNIFQENILKNPSY
FYIGHFSKYIKPGAVQLASTVNQGLFTVAFENPNGSKIVVIQNEKDKDFTVDIQGFDQKI
KFLSKAHSISTIII
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagacatattagaacaagtaatcgtgataacgaacgattagatgaaattattgttgat
gagatatttccactagaaaaagcaaccatatcggttgatccaaaccaaaaaatgcaagaa
atcattggttttggtggtgcgtttactgaagctagtgcatataatttgttaagggtaaat
aaagaagaacgtcaaaaagcaatcaatgcttactttgatccggtagatggacttggatat
tcgattggtagagtatcaatacatggatgtgattttagtttaaatagttacttatatata
gatgactatgatgatacacttgaatcattttcaattaaaagagatcagcctatcattgat
ttaatcaaagaagcatctgaagttagaggtcaaaacataaaaattctagcttctccgtgg
actccaccattttggatgaaagataacaactcaccaatcaaaggggggaaactcttacct
aagtacgatgacatttgggcgaaatattttgttaagtttattcgggcatacgaaaaagca
ggtatagatgttttttctgtaactgttcaaaatgaacctatggcagttcaacgatgggat
tcatgtatctatgaagcagaagatgaagctagatttgtaaaagttttaggtaagactttt
gaaaaagaaaaactagatcaaaaaatatacatttgggatcataatcgtgatttaatgctt
gaaagaactaaaaaagttctatcagacccagaagcttataaatatgtctacgggacagca
tttcactggtacgataatgaattatttgatgaagtcaaaaaaacacacgatgctttccca
gataaacacttattatttaccgaagggtgtcaagaaaacggaccgcatccaagtgattat
gcagttggagaaagatatggtagaaacatcattcatgatttaagaaattataacgaagga
tatattgattggaatttgtttttagatgatactggtggccctaatcatgtgaacaattta
tgttcatcaccgattatagtcaatattttccaagaaaacatattgaaaaatcctagttat
ttttatattggtcatttttctaaatatatcaaaccaggagcagttcaactggcttcaaca
gtaaatcaaggattatttactgtggcttttgaaaatccaaatggaagtaagattgtagtg
atacaaaacgaaaaagataaagattttacagttgatatccaaggattcgatcaaaagatt
aaatttttaagcaaagcgcatagtatatcaacaataattatttaa

DBGET integrated database retrieval system