KEGG   Tribolium castaneum (red flour beetle): 100142047
Entry
100142047         CDS       T01046                                 
Name
(RefSeq) inaD-like protein
  KO
K13804  inactivation no afterpotential D protein
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04745  Phototransduction - fly
Brite
KEGG Orthology (KO) [BR:tca00001]
 09150 Organismal Systems
  09157 Sensory system
   04745 Phototransduction - fly
    100142047
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 Peptidase_M50 DUF6288 Shufflon_N FYRC
Other DBs
NCBI-GeneID: 100142047
NCBI-ProteinID: XP_015837295
Position
LG7:8252504..8322503
AA seq 1731 aa
MVLNTEWAQVEVIDLINDGSGLAFGIIGGRSTGVVVKTILPGGVADRDGRLQSGDHILQI
GEVNLRGLGSEQVASVLRQCGIHVRMVVARPVESTSADYQALGSHAPIVPTKILGDPVEL
DRHLIENGYAETSTHQPPSSFTTPYIYSSQNSNFQLHVSDFTPRLMQIDAEFQPITGAVD
VVKNPLPIGDVPAPPPTTGPVITNMLPLDMALHEPNLPETETYSVELRKDDLGLGITVAG
YVCEREEISGIFVKSISKGSAADLTKKIKINDRIVEVDGISVVGHTNHQAVELLRSTGPV
VSIKFERYLRGPKYEQLQQAIKANELRPPSPVSPTISSLPKVPLSLVQMSYLGIEPEGES
RTSFDFDSAVLSEGPDRDDEEIVIDGRRSLEFSIDSHESIYDKWKEKVRDDVEIVIAQMQ
KEPSSGLGISLEGTVDVEDGKEVRPHHYIRNILPDGPVGRNKVLQAGDELLEVNGIQLMG
LNHLEVVSILKQLPNFVSLVCARYPVPIRIIDTSQHREAFQARKILAGSLQTLIPNNDRL
VKAKSETSIASSFNSEQCNGSRSRSLELIAGLPMWSSEPTIVELIKGDHGLGFSILDYQD
PLNPQETVIVIRSLVPGGVAQLDGRLIPGDRLLSVNNINVENATLDKAVQVLKGAPKGPV
RIAVAKPLTATDAVSHASQDTEDDQTCLEDFQECIEEYQECLEVVHICIDEDNSSFNRSA
STSQIEDLGQNLINAQKSLTKSDFLENNNLLKVKQKGSIGDSDLDISYKSTNDHLNNKIE
CDNKITPLKTVIDNNKALNKTDSLTQSDKGSNQDGYETCIDESFSDEAPRNNNQDPEEEP
TPTNSKMNISAPCTDSEAVTVVTAASEPCLTEQYSNHIYLDTKSDGEPKSYEWLGEDEFF
LVQYSPDEVSKSYGDLRPRKLTYRLKEYYNDYKDCLESYKIYTEDDKKTEMSDDLIFNEI
LLPFKSRSAPNIMDSSFVTLTYDPGPDRGRRKSDVPPGHQPDSDAPLPMTVIKPIDSETS
ALRGSQVEDMLQKHWGSTHTIKVYREPNASLGISIVGGKVDIQSNDASDKVLGIFVKQVV
PDSPAGKLGLFKTGDRILEVSGVDLRHESHEKAVEAIRNAENPVTFVIQSLIPWNCENED
ESYKSNENICPSPFPSPVSEKAPVAFNPPEITISHDDDHKEVNESENEKLEEKVDDGNDK
ESEKISVPLNEADVIIRDESLEDSEEDEEIDIRYMEGRTFSSKGQQIDRASAGNYRRSKE
ESEADAEEEDDFGYTTNKVKKKYASLGHTILMVQLERSSQGLGLSLAGHKDRNCMAVFVC
GLNPNGAAYKTGGIQIGDEILEVNGVVLHGRCHLNASAIIKGLSGPIFKVIILRRKTAID
DIAVKPITQFPVSLAEEASEEQFSASYPNVRTVAIKKGNQSLGIMIIEGKHAEVGQGIFI
SDIQEGSSAEKAGLEIGEMILAVNKDSLVGSNYDTAANLLKRTEGLVNLVVSNPGKKDSA
VTQANAVDNTKQNAVSKPTLKPSSGPPSRPSTPVPEPAVDLTTCPITPGKDVAIEIPTDN
KGLGVFFVGGKDTAMPNGIVIVEVYPGGAADRDSRLQAGDQILEVNGTQLKDVTHTTAAQ
ALRQTLPKMKLVVYRPERVDFTKLDVELTKKPGKGMGLSVIARKSGKGVYIGDIINGGTA
DVDGRIMKGDLLVSVNGQSVENSSRDEAGAILKTVTGRVSLKLHRYKPVAR
NT seq 5196 nt   +upstreamnt  +downstreamnt
atggtgttgaacaccgagtgggctcaggtagaagtaatcgacttgatcaacgacggctcg
ggcttggctttcggcataatagggggccgtagcaccggcgtcgtcgtcaaaaccatccta
ccgggtggtgtagccgatcgggacggccgcctccagagcggggaccacatcttgcagatc
ggcgaggtcaacctcagggggctggggtcagagcaagtggcctcggttttgcgccagtgt
gggattcatgtgcggatggtcgtcgcacgtccggtggaatcgacttctgcagattaccag
gcgttgggtagccacgcgcccatcgtgccgacgaaaatcctgggcgatcccgtcgagctc
gaccgtcacctgatcgaaaacggctacgctgaaacgtcgacccatcaacctccgtcctct
ttcacaacaccatacatctactcgagccaaaactccaacttccagttacacgtaagcgac
tttactcctcgtttaatgcaaatcgacgctgagtttcagcccattactggagccgtcgac
gtcgtcaaaaaccccttacctatcggagatgttccggcaccgccacccaccaccggaccc
gtcattaccaacatgctacctctggatatggcactgcacgagccaaatttgccggaaact
gaaacgtactcagtggaactgaggaaggacgacctgggactggggataacggtcgcagga
tacgtctgcgaaagggaagaaatatctggcattttcgtgaaaagcatcagcaaagggagt
gccgctgatctgacgaagaagattaaaatcaacgatcggattgttgaggtggatgggata
tcggtggtgggccacacaaaccatcaagcggtcgaattgctccgaagcaccggtcccgtc
gtatcaataaaattcgaaaggtatttaagaggtcccaaatatgaacagctgcaacaagct
attaaggcaaacgaacttcgaccgccatcgcccgtttcacccacgatatcgtcattgcct
aaagtacctttaagtttagtgcaaatgagttatctgggaatagaacccgagggggaatca
cgcacaagttttgattttgattccgccgtcctttcggaagggccggacagggacgacgag
gagatcgtcatcgacggccgaagatcgttggagtttagcatcgatagccacgagtcgatt
tacgacaaatggaaggaaaaagtgcgggatgacgtcgaaattgtgatcgctcagatgcaa
aaagagccaagtagtggcttagggattagtctcgaaggcacggtcgatgttgaggatggc
aaagaagtgcggcctcatcactacatcagaaatattttgcctgatggccccgttgggagg
aacaaagtgctacaagccggtgacgaattgctcgaggttaacggcatccaactcatgggt
ctcaaccacttagaagtggtctcaatactaaagcagctgccaaatttcgttagtttagtc
tgcgctcggtatccggttcctattagaataatcgacacctctcaacaccgggaagctttc
caagctagaaaaatcctcgctggtagtctccaaaccctcatccccaacaacgatcgtcta
gtcaaagccaaatccgagacctcaatagcttcgagtttcaacagcgagcagtgcaacggc
agcagatcgcgctcgttggaactcatcgccggcttgcccatgtggagcagcgagcccacc
atcgtggaattaatcaaaggcgaccatggcttaggcttttcaatactagattaccaggac
cctctcaaccctcaagaaactgtgatagttattcgatctctcgtccctggcggagtggcc
caactcgacggccggctaatccccggcgatagactcctctctgtcaacaatatcaacgtg
gaaaacgcgacactggacaaggcagtgcaagtgctcaaaggggcgcccaaagggcccgtt
cggatcgccgtggctaagcccttgactgccaccgatgccgtctcgcacgcgagtcaggat
acggaagatgaccaaacttgcttggaagacttccaagagtgcatcgaagaataccaagag
tgtttagaagtagttcacatatgcatagacgaagacaactcatcattcaaccgttcggct
agcacttcccaaattgaagacctcggccaaaatttaataaatgctcaaaaaagtttaacc
aaatcggattttttagaaaacaataatttactaaaagtcaaacagaaaggtagcataggt
gatagtgatttagacataagttacaaaagtacaaatgaccatttaaacaataagattgag
tgtgataataaaataactccattaaaaactgtcatcgacaacaacaaggccctgaacaag
accgacagcctcacacagagcgacaaaggctccaaccaggacggctacgagacctgcatc
gacgagtccttctccgacgaagcccccaggaacaacaaccaggacccggaggaggagccc
acgcccaccaactccaagatgaacatatcagccccttgcaccgactcggaggccgtcacc
gtcgtcaccgccgcctccgagccctgcctcacggagcaatactccaaccacatatacctc
gacaccaagtcggacggagagcccaagtcctacgaatggctcggggaggacgagttcttc
ctcgtccagtactccccggacgaagtctccaaaagctacggagatctccggcccagaaaa
ctcacctaccggctcaaggagtactacaacgactacaaagactgcctcgaatcctacaag
atctacaccgaagacgacaaaaaaactgaaatgagcgacgatttaatttttaacgagatt
ttactccctttcaaaagcaggtcagctcctaatatcatggacagttcttttgtgaccctc
acttatgatccaggacccgatcggggacgcaggaagtccgacgtgccgccgggacaccaa
ccagacagtgacgcgccattaccaatgacggtcataaaacccattgatagtgaaaccagt
gccctgcgagggagccaagtcgaagacatgttgcagaagcactggggctcgacccacacc
atcaaggtgtaccgggagcccaacgcgagcctgggaattagcatcgttgggggaaaagtc
gacattcagtcgaacgatgcgagcgataaggttttgggtatttttgtgaagcaagtcgtt
cctgacagtcccgccggtaaactggggctgttcaagaccggtgatagaatactggaagta
agcggagtcgatttgagacacgaaagtcacgaaaaggctgttgaggcgattagaaatgcg
gaaaatccggttacttttgttattcaatcattgattccttggaattgtgaaaatgaagat
gagtcgtacaaaagcaacgaaaatatttgcccttcgcccttcccatcgcccgtcagtgaa
aaagcaccggttgcatttaatccacccgagattaccatatctcatgatgacgatcataaa
gaagtaaatgagtcggaaaatgaaaaattggaagaaaaggtagatgatggaaatgacaaa
gaaagtgaaaaaatttcagttccattgaacgaagccgatgttattattagagacgaatcg
cttgaagacagtgaggaagatgaagaaatcgatattaggtatatggaaggaagaacgttt
tcgtcgaaaggacagcagatcgatagggcaagtgctggaaattacagaagaagcaaagaa
gaatcggaggctgatgctgaggaagaggacgattttggatatacaactaacaaggtgaag
aagaaatacgccagcctgggtcacacaatccttatggtccaactggagcgcagcagtcaa
ggtttgggcctgagtttggccggtcacaaggaccgcaattgcatggccgttttcgtgtgc
ggcctgaatccgaacggcgcggcttacaagacgggaggcatccaaatcggcgacgagata
ctcgaggtgaatggtgtggttttacatggacgctgtcatttgaacgcttccgctatcatt
aaaggcctttctggaccgatttttaaagtcattatattaaggcggaaaactgccatcgat
gacatcgcagttaagcccatcacacaatttccagtttccttggcggaggaggcctccgag
gagcagtttagcgctagctatcccaatgtacgaaccgtcgctatcaaaaagggcaaccag
agcttaggtataatgataatagaaggcaagcatgcggaagtgggccaaggtatattcatc
tcggacatccaagagggcagttcagccgaaaaggccggcctagaaatcggcgaaatgatc
ctggccgttaataaagactccctagtcggctccaattacgacaccgccgccaacttgctg
aagaggaccgagggtttggtgaacctcgttgtgtccaatccggggaaaaaagattcggcg
gtaacgcaagccaacgccgttgacaacaccaaacaaaacgccgtttccaaacccactctt
aaaccttcttccgggcccccgtcgagacccagcacgccagtacctgaacccgccgtagat
ctcacgacatgtccgataacgccgggaaaagacgtcgcgatcgaaatcccaacggacaac
aaaggcttgggcgtattcttcgtaggcggcaaagacaccgcgatgccgaacggaatcgtg
atcgtggaagtgtatcctggcggagcggccgacagggatagccgcctccaagccggcgac
cagatcctggaggtcaacgggacccaactcaaggacgtaacacacaccaccgccgctcag
gcgctgagacaaacactgccaaagatgaaactggtcgtctatcgaccggagagggtcgac
ttcaccaagctggacgtggagctgaccaagaagcccggcaagggtatggggctgagcgtc
atcgcccggaaatccgggaagggcgtctacatcggcgacattataaatggagggaccgcc
gacgtggacgggaggataatgaaaggggacctattagtgtctgtgaacgggcaaagtgtc
gaaaattcgtcacgtgatgaagccggggccattcttaagactgtcacgggcagagtttca
ctcaaattacacagatataaaccggtcgcgagataa

DBGET integrated database retrieval system