KEGG   Tribolium castaneum (red flour beetle): 100142385
Entry
100142385         CDS       T01046                                 
Name
(RefSeq) N-acetylneuraminate lyase
  KO
K01639  N-acetylneuraminate lyase [EC:4.1.3.3]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00520  Amino sugar and nucleotide sugar metabolism
tca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100142385
Enzymes [BR:tca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.3  N-acetylneuraminate lyase
     100142385
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-GeneID: 100142385
NCBI-ProteinID: XP_001813448
UniProt: D6WME9
Position
LG5:11530406..11532106
AA seq 302 aa
MVNFTFRGLMAPTLTAFKNDWTVDLSVIQDYAKFLADSKIMGVLVNGTSGEGMSLNVRER
KQVAEEWVKAVKKTNQHLMVQVGGAPLPDVLELAKHAESIGVHSLLCLPDLYNKPANSAD
LIRYLKTVGAAAPNTPLLYYHIPSYTNVNIHMGQFLNDSVGKIPTFHGIKFTSTALDEGV
AAVEANGGKYAVFLGADQLMAGAFTLGFDSAIATSLNMFPQLGVKILDAVKQSKLNSARE
TQQLLTKVCSVVTKHGPWVPTMKVAMDLFTPIKVGKAREPLTNITPEQVKEMGATMKTIN
YC
NT seq 909 nt   +upstreamnt  +downstreamnt
atggttaattttacatttaggggccttatggcaccaactctcactgcttttaaaaatgac
tggacagtggatttaagtgttattcaagattatgcaaaatttcttgctgattcaaaaatt
atgggtgttttagtaaatgggacaagcggcgaggggatgtctttgaacgtacgagaaaga
aagcaagtggctgaagaatgggtcaaagcagtgaaaaaaacaaaccagcatttgatggta
caagtgggcggagcacccttgcctgatgttctggaacttgcaaaacatgccgaatcaatt
ggagtgcattccctcctttgcttacccgacctttacaacaaacccgcaaattcagctgat
ttgatcaggtacttgaaaactgtgggggctgccgctccgaacaccccccttttgtattac
cacataccgagttataccaacgtcaatatccatatgggacaatttttgaacgattccgtc
ggtaaaatcccgactttccacggaattaaattcacttcgaccgccttagacgagggtgtg
gctgccgttgaagccaatgggggcaaatacgcggtgtttttaggggctgatcagttaatg
gcaggggctttcactttgggttttgactccgcaattgcaacaagtctaaatatgtttccc
caattgggagtgaaaatcctggacgcggtcaaacaatcgaaactaaatagcgcaagagag
acgcaacaacttttaactaaagtttgctccgtcgttaccaagcatgggccttgggtgccc
accatgaaagtcgccatggacctatttacacccattaaagtgggcaaagcacgagaacca
ttgaccaatatcaccccagaacaagtgaaggaaatgggggccacaatgaaaacaatcaat
tattgttaa

DBGET integrated database retrieval system