KEGG   Tribolium castaneum (red flour beetle): 100142537
Entry
100142537         CDS       T01046                                 

Name
(RefSeq) AP-1 complex subunit gamma-1
  KO
K12391  AP-1 complex subunit gamma-1
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04142  Lysosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100142537
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tca04131]
    100142537
Membrane trafficking [BR:tca04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    100142537
SSDB
Motif
Pfam: Adaptin_N Alpha_adaptinC2 Cnd1
Other DBs
NCBI-GeneID: 100142537
NCBI-ProteinID: XP_001812763
Position
LG9:complement(5532084..5543331)
AA seq 873 aa
MYPYYESEWSVLPPELNRRFNPAFNMATIKQAVNEAIERVRMPTPMRLRDLIRQIRAART
AAEERSVVNKECAYIRSTFREEDSVWRCRNIAKLLYIHMLGYPAHFGQLECLKLIASSRF
TDKRIGYLGAMLLLDERQDVHLLITNCLKNDLNSTTQFVVGLALCTLGAIASPEMARDLA
GEVERLMKSPNAYIRKKAALCAFRIIKRVPELMEIFLPATRSLLSEKNHGVLITGVTLIT
EMCENSPDTLNHFKKIVPNLVRILKNLILAGYSPDHDVSGVSDPFLQVKILKLLRVLGRN
DADASEAMNDILAQVATNTETSKNVGNTILYETVLSIMDIKSEGGLRVLAVNILGRFLLN
NDKNIRYVALNTLLRTVHVDTSAVQRHRSTILECLKDPDISIRRRAMELSFALVNSQNIR
TMMKELITFLEKADPEFKAHCSSSIVMAAERFAPNKRWHLDTLLKVLVGAGNYVRDDVIS
STIQLISESTNQQSYMTLQLYKALSEDLMDKQPLIQVAVWAIGEYGDQLLQASIDDDSGI
TPPTEEQVIELYQKLLWSPQNTTVTKQYALMSLTKLSTRFTVTTNKIQQIVSSFCSSLHI
ELQQRGVEFSQFFGKYSHLRPSLLERMPPMEVVRQTGETHTNGDIENDSKTPEESPQHVN
SDSNALLDLLVDFGGTAPAPPQPAPTTTSNKVDLLDLFNEMDNIDTPALQTLPPTDTNLG
LIVENNNGSLPIVINQNSNFIGGDLLSNTKTGVNEKDVPTITAYDKDGLKMCFSLEKVPD
SNTLTINMVATNLTLSAMTDFLFQAAVPKTFQLQMMSPSGTVMGPNGQITQVLRVTNPNR
STLKMRIRLSYTVDGNPVQIQTEVNNFPTEIWD
NT seq 2622 nt   +upstreamnt  +downstreamnt
atgtacccgtactacgagagcgagtggagcgttttacccccagagttgaaccgaaggttc
aatccggcctttaacatggccacaatcaagcaggcggtcaacgaggccatcgagcgagtg
cgaatgcccacccccatgcggctgcgggacctgatcaggcaaatccgggcggctaggacg
gccgccgaggagcgcagcgtcgtgaacaaggagtgcgcctacatcaggtcgacgttccgc
gaggaggactccgtgtggcggtgtcgcaacatcgccaagctgctctacatccacatgctg
ggctacccggcccatttcgggcagctggagtgcctgaagctgatcgcgagttcgcggttt
acggataagcggattgggtacttgggggcgatgctgctcctggacgagcggcaggacgtg
catttgctgatcacgaactgtctcaaaaatgacctgaattccacgactcagtttgttgtg
gggttggcgctgtgcacgttaggggcgattgcttcgccagaaatggcacgtgatcttgcg
ggggaagtggagcggctaatgaagtcgcctaacgcttatattaggaaaaaagcagctctg
tgcgctttccgaattattaaacgtgtgcctgaactcatggagatatttttaccagccacc
aggagtctactatctgagaaaaaccatggtgtgctaatcacgggggttacgctcattacg
gaaatgtgcgagaatagcccagacaccttaaaccacttcaaaaaaatcgtgccgaacctc
gtccgcatcctcaaaaacctaatcttggccggttattccccggaccatgacgtgtccggc
gttagcgatccattcctccaagtgaaaatcttaaaactgttgcgagttttgggtcgcaat
gatgccgacgcttccgaggcaatgaacgatattctcgcccaagtcgcaacaaacaccgag
acgagtaaaaacgtcggcaacactattctctacgagactgtgctctcgataatggatata
aaatcagaaggtggtttacgagtccttgctgttaatattctaggccggtttttgttaaat
aatgataagaatattcgttatgtggctttgaacacgttgttgaggaccgtgcatgtcgat
acttcggccgtccagagacacaggtcgacgattcttgagtgcttgaaagacccggatatt
tcgatcaggaggagggcgatggagttgtctttcgctttggtcaattcgcagaatattagg
acgatgatgaaggagttgattacgtttttggaaaaagctgatccggaatttaaggcccat
tgttcgtcgagtattgtgatggcggccgagaggtttgcgccgaataagaggtggcatttg
gatacgctgctcaaagtactggttggggctgggaactacgtgcgtgatgacgttatttct
tcaacgattcaattaatctcagagagcactaatcagcaatcttatatgaccttgcaacta
tacaaagctttatccgaggacttgatggacaaacagcccttgattcaagtagccgtctgg
gctattggcgaatacggagatcagcttttacaagcatcgatcgacgacgactctggaata
acacccccaaccgaagaacaagtgatcgaactttatcaaaaattactctggtcaccgcaa
aacacaaccgtgaccaaacaatatgctttgatgtcgctcactaagctaagtactaggttt
acagtcactacaaacaaaatccaacaaatcgtcagctcgttctgctcgagcttgcacata
gagttgcagcagagaggtgtagaattttcgcagtttttcggcaagtattcgcacttaaga
ccgtcgcttttggagcggatgccccccatggaggtggtgcggcaaacgggggagacgcac
accaacggcgatatcgaaaacgactcgaaaacgcccgaggagagcccccaacacgtcaat
agtgattcgaacgctttgttagatttactggttgatttcgggggcacggcgcccgcgccc
ccacagcctgcccccacgacgactagtaacaaagtagatctactcgatttgtttaacgaa
atggataatattgacacgccagccttacaaactctgccgcctactgacacgaatctggga
ctgatcgtggaaaataataacgggagtttgcctattgttatcaatcagaactcgaatttt
attggaggagatttgttgtccaacactaagacgggtgttaatgaaaaagacgtgcctacc
atcacggcgtacgataaagatgggctgaaaatgtgcttctcgttggagaaagtgccagat
agtaacactttgacgataaatatggtcgcgacaaatctgacgttatcggcaatgaccgat
ttcttattccaagcggcagttcctaagacattccaactacaaatgatgtccccctctggg
actgtgatgggtccaaacgggcaaataacgcaagtgttgagggtaacaaatcccaatagg
agcactttaaaaatgcgaataaggttgtcttacaccgttgacggcaaccctgtgcagatt
cagacggaagtgaacaatttcccgacggagatttgggattga

DBGET integrated database retrieval system