KEGG   Tribolium castaneum (red flour beetle): 100142590
Entry
100142590         CDS       T01046                                 
Name
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5
  KO
K03949  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 5
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00190  Oxidative phosphorylation
tca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100142590
SSDB
Motif
Pfam: ETC_C1_NDUFA5 FATC
Other DBs
NCBI-GeneID: 100142590
NCBI-ProteinID: XP_008197831
UniProt: D6X292
Position
LG9:complement(7204350..7204841)
AA seq 123 aa
MSGVLKQTTGLTGLAVSKNPHHTLGVLYGKILRTLQKMPQEAAYRKYTEEIVNERAQALK
QNTTVEGIERQVGCGQVEELIVQAENELILARKMLTWKPWEPLLKEAPANQWAWPPAKPP
KTC
NT seq 372 nt   +upstreamnt  +downstreamnt
atgtcgggggttttgaagcagacgacggggctcacggggctggccgtttcgaagaaccct
caccacactttgggtgtgttgtacggcaaaatcctgcgaaccttgcagaagatgccccag
gaggcagcttataggaaatacaccgaggagatagtcaacgagagggcgcaggccctgaag
cagaatacgacagtcgaggggattgagagacaagtgggttgtgggcaagtcgaggaactt
atagtccaagctgagaatgaactgatcctggctcgcaaaatgctgacctggaagccttgg
gagccccttctgaaggaggcccccgcgaaccagtgggcctggccaccggcgaagccgcca
aaaacgtgttag

DBGET integrated database retrieval system