KEGG   Tribolium castaneum (red flour beetle): 100142620Help
Entry
100142620         CDS       T01046                                 

Definition
(RefSeq) heat shock cognate 71 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03040  Spliceosome
tca04141  Protein processing in endoplasmic reticulum
tca04144  Endocytosis
tca04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100142620
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100142620
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100142620
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100142620
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tca01009]
    100142620
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tca03041]
    100142620
   03009 Ribosome biogenesis [BR:tca03009]
    100142620
   03110 Chaperones and folding catalysts [BR:tca03110]
    100142620
   04131 Membrane trafficking [BR:tca04131]
    100142620
   03051 Proteasome [BR:tca03051]
    100142620
   03029 Mitochondrial biogenesis [BR:tca03029]
    100142620
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tca04147]
    100142620
Protein phosphatases and associated proteins [BR:tca01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100142620
Spliceosome [BR:tca03041]
 Complex B
  Other components
   Prp19 complex
    100142620
 Complex C
   Prp19-CDC5 complex
    100142620
Ribosome biogenesis [BR:tca03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100142620
Chaperones and folding catalysts [BR:tca03110]
 Heat shock proteins
  HSP70 / DNAK
   100142620
Membrane trafficking [BR:tca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100142620
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100142620
Proteasome [BR:tca03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100142620
Mitochondrial biogenesis [BR:tca03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100142620
Exosome [BR:tca04147]
 Exosomal proteins
  Proteins found in most exosomes
   100142620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl DUF1464 FGGY_C
Motif
Other DBs
NCBI-GeneID: 100142620
NCBI-ProteinID: XP_015833401
Position
LG3
AA seq 643 aa AA seqDB search
MATGLVSLPIGIDLGTTYSCVGVFSNGTVNIIANDQGNRTTPSFVAFTDVERLVGDPAKG
QVALNPENTVYDAKRLIGRKFNDPAVQHDMKLWPFQVINDNGKPKIRVRYKGETKTFFPE
EISSMVLGKMKETAEAYLGTHVTGAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPT
AAAIAYGLDKKGSTERNILIFDFGGGTFDVSILNLADGIFEVKSTAGDTHLGGEDIDCRM
VDFFTEEFKRKHKIDLKNNKRALRRLQTACERAKRTLSSATQASVEIDSLANGVDFYTNI
SRAKFEELNGDIFRRTLEPVEKALRDAKIDKSKIDDIVLVGGSTRIPKIQSLLQSLFQGK
ELNKSINPDEAVAYGAAVQAAILSGDNSEAVRDILLLDVTPLSLGIETAGGVMAVLIQRN
TTIPVKHSQIFSTFADNQPGVSIQVYEGERSMTRDNNLLGKFELMGIPPAPRGVPQIEVS
FDIDANGILNVSAVENATGKTNQITIRNDKGRLTKEQIEKMVTEAEKFKEQDQQMKATVA
SKNDLEAYVYQMKNLADDPTVASKLSPADKTLLSNTCKEAVEWMGKNQSATEEQNVRKKE
EIENKLKPIIMKLYAGPGQSSQRQFPSHDNNNRGNGPIIDEVD
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggccaccggactcgtttctcttcccatcggcatagatctagggacgacgtattcatgt
gtcggtgttttctcgaacggaactgttaatatcattgcaaacgaccaaggaaaccgtacg
actcctagttttgtcgcttttacggatgtggaaagacttgtcggggatccggcgaagggt
caagtggccctgaaccccgaaaacaccgtctacgatgcgaaaagattaataggacgaaaa
ttcaacgacccggccgtccagcacgacatgaaactgtggcccttccaagtgattaacgat
aacgggaagccgaaaattcgggtccggtacaagggcgaaacgaagactttcttcccggaa
gagatctcctccatggtccttggcaaaatgaaggagacggcggaggcctatctcggaacg
catgtcacgggggcggttatcaccgtccccgcgtacttcaacgactcccagaggcaggcc
acaaaggatgccgggaccatagcgggcctgaatgtcctgaggatcatcaacgagcccacg
gcggccgccatcgcctacggcctcgacaaaaagggttctaccgaacgaaatattttgatc
tttgacttcggtggaggcacttttgatgtctcgattctcaacttggccgacggaattttt
gaagtgaagtcgaccgctggcgacacccacttgggtggtgaagacatcgactgtcgtatg
gtcgatttcttcactgaagagtttaaaagaaagcacaaaattgatttgaaaaacaacaaa
agggctttgagacgtctccagaccgcgtgcgagcgtgccaaaagaacgctatcctcagca
acacaagccagcgtcgaaatcgactcgttggcgaatggagtcgatttttacaccaatata
agtcgtgcgaaatttgaagaactgaacggcgatattttccggaggacgctagagccggtg
gaaaaggcgctccgggacgccaaaatcgacaaaagcaagatcgacgacatcgtgctcgtc
ggcggctcgacccgaatcccgaagatccagtcactcctccagagtctgttccaaggcaaa
gaactcaacaaatcaatcaatccggacgaggccgtggcgtatggggcggccgtgcaggcg
gccatcctgtcaggagataattcagaagccgtccgtgatatcctcctcctggacgtgact
cctttgtcgttaggaattgaaacggccggaggcgtcatggccgtgttaatacagagaaac
accacaattccggtgaaacattcacagatattttccactttcgccgacaaccagcccgga
gtctcgatccaggtgtacgaaggcgagcgcagtatgacgcgtgataacaacttattaggg
aaattcgagctcatggggataccgccggctccgcgaggtgtcccgcaaatcgaggtgtcg
ttcgacattgacgccaacggtattcttaacgtatcagcggtcgaaaacgccaccggtaaa
accaatcaaataaccatcagaaacgacaaagggcgactcacgaaagagcaaattgagaaa
atggtcaccgaagccgaaaaattcaaagaacaagaccagcaaatgaaggccacggtggcg
agcaaaaatgacctggaagcctatgtgtaccagatgaagaatttggcagacgacccgact
gtggcgtcgaaactatcaccagctgataaaacactcctgagtaacacatgcaaggaggca
gttgagtggatgggcaaaaatcagagcgctaccgaagaacaaaacgtgcgtaagaaggaa
gaaatcgaaaataagctaaaaccgatcattatgaaattgtacgcggggcctggacaatca
tcgcaaaggcaatttccatcccacgacaacaataacaggggaaatggaccgataattgac
gaagttgattaa

DBGET integrated database retrieval system