KEGG   Tribolium castaneum (red flour beetle): 103313682Help
Entry
103313682         CDS       T01046                                 

Definition
(RefSeq) separin
  KO
K02365  separase [EC:3.4.22.49]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tca01002]
    103313682
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tca03036]
    103313682
Enzymes [BR:tca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     103313682
Peptidases [BR:tca01002]
 Cysteine Peptidases
  Family C50: separase family
   103313682
Chromosome and associated proteins [BR:tca03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Separase
    103313682
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT
Motif
Other DBs
NCBI-GeneID: 103313682
NCBI-ProteinID: XP_008195803
Position
LG7
AA seq 595 aa AA seqDB search
MENKENIPTKKILRQLPPLHYPSGLFYQRLERIKACKCLKSNELQAIHHLVESHVPSLRL
KTAIRYEKTLSSVTDNVKLLSLDKSYVASSCPNTEIKKNISSLLSKIEEMPPEWTLVQIT
PQFTCKANVEIAADEHHTNPLYISVFNCGPNQPKPFCVSISAPHDSVKGAPVELAKEMHS
IFADNKELLLKSSKQKHFANVSQKHHYYCQRKSIDDRLEMVVRDLSNLYLKEWKCLFMGK
YINSDLENRIRKRIEDFFRTEFPWLKLDEKTKVIVQYLIKSYYYLKMTELRSALQFLFPE
KNVQRSVGQFIRDLLEEFKLFQEKRHPLILIIDDSLDIYPWEMMEILSETTVSRLPSLHL
AYALYQEHKDSMEGGFKILKNPQSGTYLINPDLDLVNMQNRIESFCDYWLPTWEGITGAR
PTSEQFVKLLLSGDVFSYNGHGSGSHFFSATNVEKIRINAVVVLFGCGSTRLTRLGPQSE
MATASHVYLIACSPCTVGMLWEVTDLDTDILATEFLSYWIPCSKVHWKHLDKAKWKKGEK
VNFSKQHFDPPPTCHTHEPELLKALSAVKKSSEINFYATRAACVARGIPVKIATN
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaaggaaaacatcccaacaaaaaaaatcttgaggcaattgccccctcttcat
tatccctccggtttattctatcaaagattggaaagaattaaagcctgcaagtgcctcaaa
agcaacgaattgcaagcaatacatcatctagtcgagtctcatgtgccaagtttgcggctt
aaaaccgccatacgctacgagaaaactctatcttcagtcacagacaatgtaaagttattg
tctttggacaagagttatgtcgcctcgagttgcccgaacacagaaatcaagaagaacatc
agtagtttactcagcaaaattgaagaaatgccgcctgaatggactttggttcaaattaca
ccacaatttacttgcaaagcgaacgtggaaatagccgcagatgaacatcacacaaaccca
ttgtacatttctgtgttcaactgtggtccaaaccaacccaaaccgttttgtgtcagtatt
agtgcacctcatgacagtgtcaagggggctcctgttgaactagccaaagaaatgcactcc
atatttgcagacaacaaagaactcttactgaaatcatccaaacaaaagcattttgctaac
gtttcgcaaaaacatcattactattgccagagaaagtcaattgatgacaggctagaaatg
gttgtcagggacttgagtaacttgtatttgaaagagtggaagtgtttgtttatgggaaaa
tacatcaacagtgatttagaaaacagaatacggaaacgaattgaagatttttttagaaca
gaatttccgtggcttaaattggatgagaaaaccaaagttattgtgcagtatttaataaag
agttattattatttaaaaatgactgaattacggagcgctttacaattccttttcccggaa
aaaaatgtacaaagaagtgttggccagttcattagggacttgttggaggaatttaagctt
ttccaagagaaacggcaccctttaattttaattattgatgatagcctagacatttaccct
tgggaaatgatggaaatcttatcagaaacgacagtttcgagactaccatccctacatttg
gcttatgccttatatcaagagcacaaagacagtatggagggtggttttaaaattttaaaa
aatccacaaagtggcacatatctcattaacccagacttagacttggttaatatgcaaaat
cggatagaaagtttctgtgattattggttacccacatgggaggggattaccggtgcgagg
ccgacgagtgaacagtttgtaaaactgctcttatcaggagacgttttctcttataacgga
catgggagcggttcgcattttttctccgcaactaacgttgagaagattcggataaatgct
gttgttgtcttgttcggttgtggcagcacacgcttgacgaggctagggccccaaagtgaa
atggccacggcctctcatgtgtatttaattgcttgcagcccttgtactgtgggaatgcta
tgggaggtcacagatctggacactgatattttggcgactgaatttttgagttactggata
ccgtgttcaaaagtccattggaaacacctggataaggcgaaatggaagaaaggcgaaaaa
gtaaatttttcaaaacaacactttgatccgccacccacttgccacactcacgagccagag
ttgttgaaagccctaagtgccgtaaaaaaatcatcagagataaacttctacgcaacccga
gcggcatgtgtggcacggggaatccccgttaaaatagccacaaattaa

DBGET integrated database retrieval system