KEGG   Tribolium castaneum (red flour beetle): 641465
Entry
641465            CDS       T01046                                 

Gene name
Pan
Definition
(RefSeq) pangolin
  KO
K04491  transcription factor 7-like 2
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    641465 (Pan)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tca03000]
    641465 (Pan)
Transcription factors [BR:tca03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    641465 (Pan)
SSDB
Motif
Pfam: HMG_box HMG_box_2 CTNNB1_binding
Other DBs
NCBI-GeneID: 641465
NCBI-ProteinID: NP_001034490
UniProt: Q5RT68
Position
LG3
AA seq 790 aa
MPHVSSSGGDDLGSTDEVKVFKDEGDGEDEKRSSENLTEEKSSLIDLTESEEKSGGSYSS
NKNVSRADHSPVFGKVEPVPHTSSFNMGYLVSPYSYANGAAGPIPVSMASKMGLAPTGHP
GAALPFFCHNGDPLSQPPPAHMGIPPYQLDSKTAGSMGLTRPPMYPFPAGQYPYPILSPE
MSQVAASWHTPSMYPLSPGAGFRSPYPSALPISTSSLPSDFYRFSPTGLIPPHPGLSPHP
PHLSSHPAIVTPGPKQELPDLNHKPLNLTIKKMPIAIVAPFTIVEPKLNKHEDLPQDLSM
KLSKNNDQCLDLSKTKETNLEKSNLNHNEQLRKYLCKNEDETKNHYSKNTYNEQGNKLAD
LYKSLGPDSVYSFINNLTDRKLLSAWYMNTVLGHQNPYLALPKTDSSDNRILNNLLDKKP
YSTYKFPTNFDALIVNEMRSEKPESKKDKKGSQVDHKNNLGDSKNNQDGNNGEKKKPHIK
KPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALGREEQAKYYELARRERQLHM
QLYPDWSSRANATRGKKRKRKQDPADGGNSMKKCRARYGLDQQNQWCKPCRPREQLTWRR
NFHGPHRLAARSRRCCYHAVAPGTDIRQSIALSRKKKCIRYMEAGDGNDGNQSDDNLGSC
GSMGDAHTPPEDDAESLNQSISSPGALSGLSSLTSPGGMVLPSPSTSVASPSVSVASPYM
LQSPLTPHEAFDVKLPPPPHPHHQPPRNPVGTNPHDINNPLSVNQLTGQCVRNDSSDTNG
KETRSIISVT
NT seq 2373 nt   +upstreamnt  +downstreamnt
atgccacacgtctcgtccagtggcggcgatgatctcggcagcaccgatgaggttaaggtg
tttaaggacgagggcgacggggaggacgagaagaggtcctctgagaacctcaccgaggag
aagagcagtctcatcgacctcaccgagtcggaggaaaagtctggtggcagttactcttcc
aataaaaatgtctcccgagcggaccacagtcccgtcttcggcaaggtggagcccgtgccc
cacacctcttcgttcaacatgggatatttggtgtccccctacagctacgccaacggagcg
gctggccccatacccgtgtcaatggctagtaagatgggcctggcgccaacgggacacccg
ggagccgccctacccttcttctgccacaacggagaccccctgtcgcagccgccgccggcg
cacatgggcatccccccctaccagctggacagcaaaaccgcgggttccatgggactcacg
agaccaccgatgtacccttttcctgctggccagtacccttaccccattctcagtcctgaa
atgtcacaggtggcggcttcatggcacacgccaagcatgtacccgctgtcgccgggagcc
ggcttcaggagtccgtaccccagtgccctcccgatctcgacgagcagcctgcctagtgat
ttctaccggttctcccccacggggctgatcccgccgcacccgggcctgtcgccgcacccg
cctcacctctcgtcgcatccggccatcgtgacgcctggacccaagcaggagttacccgac
ttgaaccacaaacctttaaacttaacaatcaagaaaatgccgattgccatcgtcgctccc
ttcaccatcgtcgagcccaaactcaacaagcacgaagacctcccgcaagacctctccatg
aagctctccaaaaacaacgaccaatgcttggacctcagcaaaaccaaagaaaccaacttg
gagaaatccaatctgaaccacaacgaacaattgagaaaatacctctgcaagaacgaggac
gaaaccaagaaccactacagcaagaacacctacaacgagcaaggcaacaagctggcggac
ctctacaagagcctgggccccgactccgtctattccttcatcaacaacctaaccgaccgc
aaactcctcagcgcctggtacatgaacaccgtgctcggccaccaaaacccctacctagcc
ctccctaaaaccgactcctccgacaaccgcattctcaacaacctcctcgacaaaaaaccc
tactccacttacaaattcccgacgaattttgacgcactcatcgtcaacgagatgcgttcg
gaaaagcccgagtccaaaaaggacaagaaggggtcacaagtcgaccacaagaacaacctg
ggtgactcgaagaacaaccaggacggcaataacggagaaaagaagaagccccacattaag
aaacccctaaacgccttcatgttatacatgaaggagatgcgagcgaaagtcgtcgcagaa
tgcacgctcaaggaaagcgccgccatcaatcaaatactcggccgaaggtggcacgcgctg
ggccgcgaggagcaggccaagtactatgagctggcgcgccgggagaggcagctgcacatg
cagctctaccccgactggtcgtcgcgcgccaacgccactcgcggcaagaagaggaagcgc
aagcaagaccctgccgatggaggtaacagcatgaagaagtgccgagcaaggtacggattg
gaccaacaaaaccaatggtgtaaaccatgcaggccccgagaacagctcacatggcggcgg
aacttccacggtccacaccggcttgctgcacgcagcaggaggtgctgctaccacgcagtc
gccccaggaaccgacatacgtcaatctatagccctctcacgcaagaagaagtgcatacga
tacatggaggcaggcgatggcaatgacgggaaccaatccgacgacaacctaggcagctgc
ggcagcatgggcgacgcgcacacgccgcctgaggacgacgccgagagcctcaaccagtcc
atctccagcccgggcgccctctcgggcctcagcagcctgacgagccccgggggcatggtg
ctgcccagcccgtcgacgagcgtcgccagcccctcggtgagcgtggccagcccctacatg
ctgcagagcccgctgacgccgcacgaggccttcgacgtgaagctgccgccgcccccgcac
ccccaccaccagccgccccgcaaccccgtcgggacgaacccccacgacataaacaatccg
ctcagtgtgaaccaattgaccggacagtgcgtgagaaatgactcctcggacacgaatgga
aaagagacacgctccattatcagcgtcacgtag

DBGET integrated database retrieval system