KEGG   Tribolium castaneum (red flour beetle): 641602
Entry
641602            CDS       T01046                                 
Symbol
Ppp2r1a
Name
(RefSeq) protein phosphatase 2, regulatory subunit A, alpha isoform
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03015  mRNA surveillance pathway
tca04350  TGF-beta signaling pathway
tca04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    641602 (Ppp2r1a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    641602 (Ppp2r1a)
   04391 Hippo signaling pathway - fly
    641602 (Ppp2r1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tca01009]
    641602 (Ppp2r1a)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:tca03019]
    641602 (Ppp2r1a)
   03036 Chromosome and associated proteins [BR:tca03036]
    641602 (Ppp2r1a)
Protein phosphatases and associated proteins [BR:tca01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     641602 (Ppp2r1a)
Messenger RNA biogenesis [BR:tca03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     641602 (Ppp2r1a)
Chromosome and associated proteins [BR:tca03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     641602 (Ppp2r1a)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Cnd1 PDS5 Adaptin_N CLASP_N Mnd1
Other DBs
NCBI-GeneID: 641602
NCBI-ProteinID: NP_001034525
Position
LG9:9625118..9629739
AA seq 590 aa
MAASDSAGDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTET
IYDEDEVLLALAEQLGSFITLVGGPEYAYCLLPPLESLATVEETVVRDKAVESLRAVAQQ
HSPADLENHFVPLVQRLSAGDWFTSRTSACGLFSVCYPRVSAQMKADLRSHFRALCQDDT
PMVRRAAATKLGELAQVVELEYLKTDLIPMFLSLTQDEQDSVRLLAVEACVSFASLFQQE
DIEMFVMPTVRNCTGDTSWRVRYMVADKFTDLQKAVGPEITRTDLVPAFQNLLKDTEAEV
RAAAANKVKDFCQNLDKAHQESIIMNNILPCVKELVADPNQHVKSALASVIMGLSPILGR
HNTIEHLLPLFLTQLKDECPEVRLNIISNLDCVNEVIGIQQLSQSLLPAIVELAEDSKWR
VRSAIIEYMPLLAGQLGREFFDEKLNALCMTWLMDHVFAIREAATLNLRKLVDQFGAEWA
ETTIIPKVLAMSRDQNYLYRMTCLFCINVLAEACGSDITTRLLLPTVLSMANDKVANVRF
NVAKTLQKIAPQLDQAVIQPQVKPVLDKLTADSDIDVKYSASEAIAGIAG
NT seq 1773 nt   +upstreamnt  +downstreamnt
atggcagccagcgattcagcaggcgacgattccttgtaccccatcgccgtcctaatcgac
gagctcaaaaacgaggatgtccagctccgactcaactccatcaagaagctctccacgatc
gcattggctctgggggtggagcgcacccgctccgagctcatccccttcctcacggagacc
atctacgacgaggacgaggtgctcctagcccttgccgagcaactggggagtttcatcacg
ttagttggcgggcctgaatacgcctactgtcttttaccgccgcttgagagcctggccact
gttgaggaaacagtcgtcagggacaaggcagtggagtcgttgagggcggtagcgcagcaa
cacagcccagctgatttagaaaaccactttgtgcccctagtccagagactgtcagcaggg
gattggtttacttcgcggacttcggcatgtgggctattctccgtttgttacccccgcgtg
tcggctcaaatgaaggcggatttgcgctcgcactttcgggctttgtgtcaggatgacacg
ccgatggttaggcgagctgccgccacgaaattaggcgaattggcacaagtcgtcgagttg
gagtatttaaaaactgatttaattccgatgtttttgagtctgacccaagatgaacaagat
tcagttaggcttttggcagttgaggcttgtgtcagttttgcctcactttttcaacaagag
gatatcgagatgtttgtgatgccgactgttaggaattgcaccggtgatacatcatggcgt
gtgcgctacatggttgcggacaaattcaccgatttgcaaaaggccgtaggaccagaaatc
acccgaaccgatttagtccccgcctttcagaacctcctcaaggacactgaagccgaagtt
cgggccgcagccgccaataaagtcaaagatttctgtcaaaacttggacaaagctcatcag
gagagcatcattatgaacaatatccttccctgcgttaaagaactcgtcgccgatcctaac
caacatgtcaagtcggccttggcttcggtgataatgggcctgagccctattctcggccgt
cacaatactatcgaacatctccttcctttgtttttgactcaattgaaagacgaatgtcct
gaagttcgcttgaatatcatctcgaatctagattgcgtgaatgaggtcataggaatccag
caattgtctcagagtttattgccggccatcgtcgaattggccgaggattcaaaatggcgc
gtccgttcggccatcatcgaatacatgccattgttggctggccaattgggacgcgagttt
ttcgatgagaaattaaacgcactgtgcatgacttggttgatggatcatgtgttcgctatt
cgtgaagcggcaactttgaatttgaggaagttggtggatcagtttggggcagaatgggcc
gaaaccacgatcattccgaaggttttggcaatgtcccgtgaccagaattatttgtatagg
atgacctgtctgttttgcatcaatgtgttggcagaggcctgcggtagcgatattacgacg
cgattgttgttaccaactgttctgagtatggcgaatgataaagtcgccaatgtaaggttt
aacgtcgctaaaacgttacaaaaaatcgcaccgcagttggaccaagcggtcatccagccc
caagttaagcctgttttagacaaattaacagcggatagcgatatcgatgtcaagtattcg
gcgtccgaagccatcgctgggattgctggttga

DBGET integrated database retrieval system