KEGG   Tribolium castaneum (red flour beetle): 654918
Entry
654918            CDS       T01046                                 

Symbol
Th
Name
(RefSeq) tyrosine hydroxylase
  KO
K00501  tyrosine 3-monooxygenase [EC:1.14.16.2]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00350  Tyrosine metabolism
tca00790  Folate biosynthesis
tca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    654918 (Th)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    654918 (Th)
Enzymes [BR:tca01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.2  tyrosine 3-monooxygenase
     654918 (Th)
SSDB
Motif
Pfam: Biopterin_H ACT_4 COMM_domain
Other DBs
NCBI-GeneID: 654918
NCBI-ProteinID: NP_001092299
UniProt: A5YVV2
Position
LG3:complement(26517373..26538072)
AA seq 532 aa
MAAVAAAQKNREMFAIKKSYSIENGYPARRRSLVDDARFETLVVKQTKQSVLDEARLRAN
DSSVDPEIDIEDKPAQKIDGEDDSGLTEEEVVLSNAIAEGPDAEKALQRAALILRLREGM
NSLSRVLKSIEKHQGAVCHLETRPNQSDNNQLDALVKVEMTRVSLLQLIKSLRQSSSLEH
CTLIGEDNISAKNPWFPRHASDLDNCNHLMTKYEPDLDMNHPGFADKEYRARRKEIAEIA
FAYKYGDPIPYIQYTETETKTWGSVFNTVLELMPKHACSEYCRVFKMLQEEDIFTPDRIP
QLEEMSNFLKRHTGFSLRPAAGLLTARDFLASLAFRIFQSTQYVRHKNTPYHTPEPDCIH
ELLGHMPLLADPSFAQFSQEIGLASLGASDAEIEKLSTVYWFTVEFGLCKESGVVKAYGA
GLLSAYGELLHALSDKPELRPFEPAVTAVQPYQDQEYQPIYFVAESFDDMKDKFRRWVSA
MSRPFEVRFNPHTGRVEVLDSVEKLETLVHQLNTEVLHLSNAINKMKAPSYQ
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggctgctgtggctgctgctcaaaaaaatcgcgaaatgttcgccatcaaaaagtcgtat
agcatcgagaacggttatcccgctcgtcggcgttcccttgttgacgacgcaaggttcgag
actttggtggtgaaacaaaccaaacaatcggtcctggacgaggctcgccttagggccaac
gattcaagcgttgatcccgaaattgacatcgaggacaaaccggcacagaaaatcgacggc
gaagacgattctggcctgactgaggaggaagtcgtcctttctaatgccatcgccgaaggg
ccagacgctgaaaaggctctgcagcgtgccgccctaatcctgcgtctacgcgaaggcatg
aactcgctctccagagtgctcaagagcatcgaaaaacaccaaggggcagtatgtcacctg
gagacgcgacccaaccagagcgacaacaaccagctggacgcgctcgtcaaggtcgagatg
accagagtcagtctcttgcaacttatcaagtcgctgaggcagtccagttcgttggaacac
tgcactttgattggagaggataatatttcggcgaagaatccctggtttccaagacatgcc
agtgatttggacaactgcaatcatctgatgactaaatatgagcctgatttggatatgaac
catcctgggtttgctgataaggagtacagggcacgtcgtaaagaaatcgcagagattgct
tttgcctacaaatatggagaccccattccctacatccagtacacggaaaccgagacgaag
acctggggctccgtgttcaacaccgtccttgagctgatgccaaaacacgcttgcagcgag
tactgtcgcgtgtttaaaatgctccaggaagaggacatttttacgccggatcgcattcca
cagctggaagaaatgtcgaactttttgaaacgccacaccggtttttcgctgcgtccggcc
gccggcttgctcacagctcgtgatttcctcgcttctctcgctttccgcatcttccagagc
acccaatacgtccgacacaagaacaccccgtaccacacgcccgaaccggattgcatccac
gaacttttgggccacatgcccctgctggcagaccccagcttcgctcagttctcgcaagag
attggattggcttctcttggcgcctccgatgctgaaattgaaaaattatcaacggtgtac
tggttcaccgtcgagttcggcctctgcaaagaaagcggcgtggtgaaagcctacggcgcc
ggcctcctcagcgcctacggcgagctcctgcacgccctcagcgacaagccggagctgcgg
cccttcgagccggccgtcaccgccgtgcagccctaccaggaccaggagtaccagcccatc
tacttcgtcgccgagagcttcgacgacatgaaggacaagttccggcgatgggtgtcggcc
atgtcgcgccccttcgaagtgagattcaacccgcacaccggccgcgtggaggtgctcgac
tccgtggagaagctcgaaacgctcgtccaccagctcaacaccgaagtcctccacctgtca
aacgctataaacaaaatgaaagcgccgtcgtatcagtga

DBGET integrated database retrieval system