KEGG   Tribolium castaneum (red flour beetle): 655144
Entry
655144            CDS       T01046                                 

Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 12
  KO
K03035  26S proteasome regulatory subunit N5
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03050  Proteasome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    655144
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:tca03051]
    655144
Proteasome [BR:tca03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     655144
SSDB
Motif
Pfam: PCI RPN5_C Paf67 Symplekin_C ABC_tran
Other DBs
NCBI-GeneID: 655144
NCBI-ProteinID: XP_966746
UniProt: D6WVQ2
Position
LG8:5935619..5939385
AA seq 451 aa
MDSIATDSGKIVKMEVDYSSTCDEKIPECQKLAQAGKLHDALDQLLALEKQTRTGADMVS
TGRVLVAIVQICKEARNWGALNEHIVLLTKRRSQLKQAVAKMVQECCTYVDQTPDKDTMI
KLIDTLRQVTEGKIYVEVERARLTHKLAKIREEEGNISEAANIIQELQVETYGSMDKREK
VELILEQMRLCLAKQDYIRTQIISKKINTKFFDDEGTQDLKLKYYRLMMELDQHEGSYLA
TCKHYRAVLNTPNIQSEPLERQKAARAVVLYLILAPHDNEQADLTHRVLADKVLEEIPMY
KQLLKLFTTSELIKWSGLCEIYEKELLSTPVFSGNEQAKKRWNDLKNRVVEHNIRVMAKY
YTRIKISRMADLLDLSPAETEEFLSQMVVSKSVQAKTDRPSGVVHFQQSKDPSDVLNDWA
HDLASLMQLVNKTTHLINKEECVHKHLQATA
NT seq 1356 nt   +upstreamnt  +downstreamnt
atggactcaatagcgaccgattccggcaaaatcgtcaaaatggaagtcgattacagctcg
acttgcgacgagaaaatccccgaatgccagaaattggctcaagctgggaaactccacgac
gctctcgaccaactcttggccctggaaaagcaaactcggactggggccgacatggtctcc
actggtcgcgtcttagtcgcaatcgtccaaatttgtaaagaggccagaaactggggggcc
ctcaacgaacacattgttctcctaaccaagagacggtcgcagttgaaacaagcggtggcc
aaaatggtgcaggaatgttgcacttacgtggaccaaacccccgataaagacacaatgatt
aagttgattgatacactacgccaggttacggaaggcaaaatttacgttgaagtcgaaagg
gcgagattgacgcataaactggcgaaaattcgtgaggaagaagggaatatttccgaagcg
gcgaacataatccaagaattgcaagtcgagacttacggttccatggataaacgtgagaaa
gtcgagttgattttggaacaaatgaggttgtgtttggccaaacaagactatatcaggact
caaatcatttcgaaaaaaatcaatacaaagtttttcgacgatgaaggcactcaagacctc
aaattgaagtactaccgactcatgatggagctggaccagcatgagggctcctatttggcc
acttgtaagcactatcgagctgttttaaacactccaaatattcagtcggagcctttggaa
cgtcaaaaggccgcacgtgcggttgttttatacttaatactagcccctcatgataacgaa
caagccgatttgactcatcgtgtcttggccgataaagttcttgaagaaataccaatgtac
aaacaactgttgaaactcttcacgacctcggaattgatcaagtggtcgggtttgtgcgaa
atttacgaaaaagaattgctctcaactccggttttcagcggaaatgagcaagcgaagaaa
cgatggaatgatttaaagaatcgtgtcgttgagcacaacatccgtgtcatggcaaaatat
tacaccaggattaaaatttcaagaatggccgatttattggacttatcaccggccgaaacc
gaggaatttttgtctcaaatggtggtcagtaaaagtgtgcaagccaagaccgaccggcct
tcaggcgttgtacattttcaacaaagtaaagatcccagtgatgtcctcaatgattgggcg
cacgatttggcatctctcatgcaactggtcaacaaaaccacgcatcttattaataaagaa
gagtgtgttcacaagcatctccaagccacggcttga

DBGET integrated database retrieval system