KEGG   Tribolium castaneum (red flour beetle): 655366
Entry
655366            CDS       T01046                                 

Definition
(RefSeq) arginase-1
  KO
K01476  arginase [EC:3.5.3.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00220  Arginine biosynthesis
tca00330  Arginine and proline metabolism
tca01100  Metabolic pathways
tca01230  Biosynthesis of amino acids
Module
tca_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    655366
   00330 Arginine and proline metabolism
    655366
Enzymes [BR:tca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     655366
SSDB
Motif
Pfam: Arginase
Other DBs
NCBI-GeneID: 655366
NCBI-ProteinID: XP_966999
BEETLEBASE: TC013057
UniProt: D6WJB4
Position
LG5
AA seq 341 aa
MFKKGSGVLWQLRKNYSTKIGIVGVPFEEGQGKVGVANGPEAMRKSNLIENIKSIHQEID
VHDYGDVCYTSLENVEVPNMRKYSDVAACNLQVSRTVEKILNDGRICLTLGGDHSIGIGT
VDGHIKAKNEKVCILWVDAHADLNTNKTSVSGNIHGMPLAILVKELADYWPYLPGMDWQK
PVLPIRNVAYIGLRSVDSYERLIIEQFGITAYGMEDVENYGIHNIVNMALDRIDPHRMLS
IHLSFDIDSLDALEAPSTGTAVRGGLTLREGIHLVEQIHKTGRLGAMDLVEVNPSIGSPK
DVQKTVEAAVHLLMAACGYTRRGLIPRGPDGSPIRTIPSPV
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgtttaaaaaaggttcgggtgtgttgtggcaattgcgcaaaaattacagtacgaaaatt
gggattgtgggggtgcctttcgaggaaggtcagggcaaagttggggttgctaacggaccg
gaagcgatgcgcaaatcaaatttaatcgaaaacataaaatcaattcaccaagaaatcgac
gtccacgactacggagacgtctgttacacgtccctggaaaatgtggaggttcccaacatg
aggaaatactcggacgtggcggcttgcaatttgcaggtctcccgaactgtcgaaaaaatc
ctaaacgatggaagaatctgcctaactctaggcggtgaccactcaatcggtatcggcact
gtggatggccacatcaaggccaaaaacgaaaaagtgtgcatactatgggtggacgcacac
gctgacttgaatacgaacaaaacttccgtttcgggaaacatccacgggatgcctcttgcc
atcctggtgaaggagttggccgattactggccgtacctcccggggatggactggcaaaag
cctgtgctaccgatccgaaatgtggcctacattggcttgaggtcggtggattcgtacgaa
aggctcattattgaacagtttgggatcacagcatatgggatggaagatgtggagaattac
gggattcataatattgtgaatatggccttggataggattgacccgcatcgcatgctttcc
atacatttgagttttgatattgatagtttggacgcgttggaggcgccgtccacggggacc
gcagtccgtggaggcctaactctgcgtgaaggcatccacctggtggaacaaatccacaag
acgggccgtctgggggcgatggacttggtggaagtgaatccctccatagggtcccccaaa
gacgtccaaaagacagtcgaggctgcggtccatttgctcatggcagcctgtggctacacg
cgtcgtgggctaataccacgaggacccgacggctcacccatcagaacaattccaagtccc
gtttaa

DBGET integrated database retrieval system