KEGG   Tribolium castaneum (red flour beetle): 655494
Entry
655494            CDS       T01046                                 
Name
(RefSeq) lysosomal aspartic protease
  KO
K01379  cathepsin D [EC:3.4.23.5]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04140  Autophagy - animal
tca04142  Lysosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    655494
   04140 Autophagy - animal
    655494
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tca01002]
    655494
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tca04147]
    655494
Enzymes [BR:tca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.5  cathepsin D
     655494
Peptidases and inhibitors [BR:tca01002]
 Aspartic peptidases
  Family A1: pepsin family
   655494
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   655494
SSDB
Motif
Pfam: Asp TAXi_N A1_Propeptide TAXi_C PE-PGRS_C Arch_flagellin
Other DBs
NCBI-GeneID: 655494
NCBI-ProteinID: XP_966517
UniProt: D6WC03
Position
LG2:complement(685574..690604)
AA seq 384 aa
MLRSSVIFFIVCVLVANAFVRVPLYKVKSARRSLQEVGTHVQQVRMRYGGPTPEPLSNYL
DAQYYGPISIGNPPQNFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSSQSKTYKKNG
TDFAIQYGSGSLSGFLSTDIVTVGGLKVQQQTFAEAMSEPGLAFVAAKFDGILGMAYNRI
SVDGVTPVFYNMIQQNLVAQPVFSFYLNRDPSAAQGGEIILGGSDPAHYKGDFTYLSVDR
QAYWQFKMDSISVGGKNTFCANGCEAIADTGTSLIAGPVSEVQGINKAIGATPIVGGEYM
VDCNLIPNLPLIDFTLGGKNFTLEGKDYVLRVAQMGKTICLSGFMGIDIPPPNGPLWILG
DVFIGKFYTEFDLGNNRVGFAVAA
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgctgaggtcaagtgtgatatttttcatagtttgtgttcttgtggcgaatgcttttgtc
cgagtgcctttatataaggtaaagtcggctagacgcagtctacaagaagtgggcacacat
gtgcaacaagtccgcatgaggtatgggggccctactcctgaacctctctccaattatctg
gatgcgcaatattacgggccgatttcaattgggaaccccccgcaaaatttcaaggttgtt
tttgatacaggatcatccaatttatgggtgccttccaagaaatgtcattatacaaacata
gcctgcttgcttcacaataagtatgattcgtcacagtcaaagacctacaagaaaaacggc
accgattttgctattcaatatggatcggggagtttgagtggattcttatcaactgatatt
gttacagttggcggtttaaaggtacaacaacaaacatttgctgaagccatgagcgaacca
ggtctagcatttgttgccgcaaaattcgacggaattttaggaatggcctacaaccgcatc
tcagttgatggtgtcactccagtcttctataacatgattcaacaaaatttagtcgcccaa
cccgtcttctcattctatcttaatagagatccaagtgctgcacaaggcggagaaataatt
ttgggaggatcagatccagctcactataaaggagactttacctatttgtctgttgataga
caagcgtattggcagttcaaaatggatagcataagtgttggtggtaaaaacacgttctgt
gccaatggttgtgaagctattgctgacactggcactagtttgatcgcaggaccggttagt
gaagtgcaaggaatcaacaaagcaataggtgctactcccattgttggaggggaatatatg
gtggactgtaacttgattccaaatttaccattgatcgacttcactctaggaggcaagaat
ttcacattggagggaaaagactatgttctaagggtggcacaaatgggcaaaactatttgc
ttgtctggtttcatgggcattgatatcccaccaccaaatgggcccttgtggattttggga
gatgtgtttatcgggaaattttatacagagtttgatttaggaaacaaccgagttgggttt
gccgttgctgcttaa

DBGET integrated database retrieval system