KEGG   Tribolium castaneum (red flour beetle): 655614
Entry
655614            CDS       T01046                                 

Name
(RefSeq) tubulin beta-1
  KO
K07375  tubulin beta
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04145  Phagosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    655614
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tca03036]
    655614
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:tca04812]
    655614
   04147 Exosome [BR:tca04147]
    655614
Chromosome and associated proteins [BR:tca03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     655614
Cytoskeleton proteins [BR:tca04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    655614
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   655614
  Exosomal proteins of colorectal cancer cells
   655614
  Exosomal proteins of bladder cancer cells
   655614
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_2 Tubulin_3
Other DBs
NCBI-GeneID: 655614
NCBI-ProteinID: XP_967267
UniProt: D6WSV2
Position
LG7:2981830..2985208
AA seq 447 aa
MREIVHIQAGQCGNQIGAKFWEIISDEHGIDPTGAYHGDSDLQLERINVYYNEASGGKYV
PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNIQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQEATADEDAEFDEEQEAEVDEN
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgagggaaatcgttcatatccaagccggccaatgcggcaaccagattggagccaaattc
tgggaaatcatctcagacgagcacggcatcgaccccaccggcgcctaccacggcgactcc
gacttgcaattggagcgcatcaacgtctactacaatgaagcctccggtggcaaatacgtc
ccccgtgccatcctcgtggacttggagcccggcaccatggactcagtccgttccggtcct
ttcggccagattttccgccccgacaacttcgtcttcggccagtccggagccggaaacaac
tgggccaagggccactacacagaaggcgccgaactagtcgactcagtcttggacgtggtg
cgcaaagaggccgagtcctgcgactgcctccaaggcttccagttgacacactcgcttggg
ggcggcaccggctccggcatgggcactctactcatctccaaaatcagggaggagtatccc
gataggatcatgaacacgtattcagtagtaccttcacctaaagtttccgacacggtcgtg
gaaccgtacaatgccacgttgtcagtccaccagcttgtagaaaacactgatgagacctat
tgtatcgataacgaagctctctatgacatctgcttcagaacgttgaaactcacaacaccg
acctacggtgacttgaaccatttggtgtcgttgacaatgtcgggagtcacgacttgtctg
cgattccccggtcaattgaacgcagatctgcgcaaattggcggtcaatatggtaccattc
ccgcgtttgcacttcttcatgcctggttttgcgcccttgacatcgaggggaagtcagcaa
taccgtgcgttgactgttcccgagctcacgcagcaaatgttcgatgctaagaacatgatg
gcggcgtgtgaccccagacatgggaggtacttgacagtggctgctgttttccgaggaagg
atgtcgatgaaggaagttgacgagcaaatgctcaacatccagaacaaaaacagcagctac
ttcgttgagtggatccccaacaatgtcaagacggccgtttgtgacattcccccacgtggt
ctcaaaatgtcggccactttcatcggcaactccaccgccatccaagagctcttcaagcgc
atctctgaacagttcactgctatgttcagacgtaaggctttcttgcattggtacaccggc
gaaggtatggacgagatggaattcactgaagccgaatcaaacatgaatgacttggtctcc
gagtaccagcagtaccaggaggcgaccgccgatgaagacgccgaattcgacgaggaacaa
gaagccgaagttgacgagaactaa

DBGET integrated database retrieval system