KEGG   Tribolium castaneum (red flour beetle): 655727
Entry
655727            CDS       T01046                                 
Name
(RefSeq) beta-catenin-like protein 1
  KO
K12864  beta-catenin-like protein 1
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    655727
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tca03041]
    655727
Spliceosome [BR:tca03041]
 Complex B
  Other components
   Prp19 complex
    655727
 Complex C
   Prp19-CDC5 complex
    655727
SSDB
Motif
Pfam: CTNNBL Arm
Other DBs
NCBI-GeneID: 655727
NCBI-ProteinID: XP_967379
UniProt: D7EK03
Position
LG5:7132443..7134437
AA seq 557 aa
MDIGELLDYKPPQGVKRPVENENDEIEKQRKMRRIARDKANRMSRAASPTPSIQTLDQIS
EEERQEILKFVETEQTEGEVIDEAAIKRIVLNFEKRSLKNREMRIKFPDSPEKFMESELE
LHEILQEMRVLSTAPDYYPLLVKLQVIPSLLELLAHDNTDVAVATVELLQELTDVDILHE
SEEGAEALIDALLDHQVIALLVQNLDRLDEKVKEEADGVHNSLSIIENLTELRNDICNEA
TKQGLLQWLLKRLKVKAPFDANKLYASELLSILLQDNEKNRTALGEMDGIDTLLQQLAFY
KRHDPSSAEEHELMENLFNCLCSALMIVSNRDRFLKGEGLQLMNLMLREKKTSRNGSLKV
LDYAMSGPHGKDNCNKFVDILGLRTIFPLFMKTPKKNRKKVLSTEEHEEHVTSIIASMLR
NCRGSQRQRLISKFTENDHEKVDRLLELHFKYLEKVEAIDEAIEEENGVEDDDASYMKRL
EGGLFTLQLVDYIIVEVCAAGPASIKQRVMQILNLRGASLKTIRHIMREYAGNLGDEGDK
EWRDQEQQHILHLVDKF
NT seq 1674 nt   +upstreamnt  +downstreamnt
atggatattggtgaattactggactacaaaccccctcaaggcgtaaaacgcccagtcgag
aatgaaaacgatgaaatcgaaaaacagagaaaaatgcggcgaattgcacgggataaagcc
aatagaatgtcccgtgccgcatccccaaccccgtcaatacaaactttggaccagatatcc
gaagaagaaagacaagaaatattaaaatttgtggaaactgaacaaacagaaggcgaagtc
attgacgaagcggcaatcaagcgaattgttctaaatttcgaaaaacggagtctcaaaaac
agagaaatgaggatcaagtttccagactcgcctgaaaagtttatggagagcgagctcgaa
ctacatgaaattttacaagaaatgagggtgttatcgaccgcacctgactattaccccctt
cttgtgaagctgcaagtcatacccagcttgctggaactgttggcacatgataacactgat
gtggcagtggcgaccgtggagctgttgcaagaactgaccgatgtggacatcctccacgag
tctgaagaaggtgccgaagccctaattgacgccttgctcgaccaccaagtgatagccctc
ctcgtccaaaacctggaccgtttggacgaaaaagtgaaggaggaagcagacggtgtccac
aactccctatcaataatagaaaacttgaccgaactccgcaatgacatttgcaacgaggcc
accaaacagggcttgctccagtggctcttgaaacggttgaaagtcaaagcccctttcgac
gccaacaaactctacgccagcgaactcctctcaatcctgctccaagacaacgaaaaaaac
cgaactgctttgggcgaaatggacggaatcgacactttgttgcaacagttggccttctac
aagcgccacgacccctccagtgccgaagaacacgagctaatggagaacctgttcaactgt
ttgtgcagcgcactgatgatcgtctcaaaccgagaccggtttctcaaaggcgagggcttg
caactgatgaatttgatgctcagagagaagaaaacctcgcggaacggctcacttaaagtg
ctggattacgcaatgtcgggcccccatggcaaagacaattgcaacaagttcgtggatatt
ttaggcctgcggaccattttccccctatttatgaaaacgccgaagaagaacaggaagaaa
gtcttgtcgacggaagagcacgaagagcacgtcacttcgattatcgcgtccatgctgcgg
aattgtcgcgggtcgcagagacaaaggctcattagtaaatttacggaaaatgatcacgag
aaagtcgacaggttgcttgagctacacttcaaatatttggagaaggttgaagccattgat
gaggccattgaggaggaaaatggagttgaggatgatgatgcgagttatatgaagcggctg
gaaggaggattgttcacgttgcagttggtggattatattattgtggaagtttgtgctgcg
ggacccgccagtattaagcagcgagttatgcaaatcctcaatcttaggggggcttcgttg
aagacgataaggcacattatgcgggaatatgccgggaatttgggggacgaaggggataag
gagtggagggatcaggagcagcaacacattttgcacttagttgataagttttga

DBGET integrated database retrieval system