KEGG   Tribolium castaneum (red flour beetle): 655857
Entry
655857            CDS       T01046                                 

Definition
(RefSeq) glycoprotein 3-alpha-L-fucosyltransferase A
  KO
K00753  glycoprotein 3-alpha-L-fucosyltransferase [EC:2.4.1.214]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00513  Various types of N-glycan biosynthesis
tca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    655857
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:tca01003]
    655857
Enzymes [BR:tca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.214  glycoprotein 3-alpha-L-fucosyltransferase
     655857
Glycosyltransferases [BR:tca01003]
 Glycan extension
  N-Glycan
   655857
SSDB
Motif
Pfam: Glyco_transf_10 Glyco_tran_10_N
Other DBs
NCBI-GeneID: 655857
NCBI-ProteinID: XP_008193532
Position
LG5
AA seq 434 aa
MKMPPRLSARRLCLVIFFFGGVTVLVTLHHRLTWPSTKSRIPSSDEDELLIHTTAPSLPV
VEEHETEQPPKSQEKAWFFGGGTLFPTASKGLPRLFPDQTDGDRIIEQLMYVPEDYQGFD
TPEKVILAYNGLGTWGQRSGPGSFHGCPVSRCSLTDDRSRAADADAILYKDHFIHPPVSR
PFNQVWIMYFLECPYHTQSIKFPDVINWTATYRRDSDLVAPYERWTYFDPQVRQKVQNRD
YSANKTKKVAWFVSNCGARNGRLAYARELSKYIQVDIYGMCGPLACPRSDKKCFDLLDRE
YKFYLAFENSNCRDYITEKFYVNGLGQNVLPIVMGARPEDYQRSAPEGSYIHVDEFAGPA
ELAAYLNRLDKDSTLYNSYFKWKGTGQFINTFFWCRLCAMLHAPRVHRHYDDINDWWRGP
GVCSSKSWRNADFV
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgaagatgcctccgcgactctctgcgcgccggctatgcctcgtaatcttcttcttcgga
ggtgtcacagtgctggtgactttacatcatcggctgacatggccctcgaccaaatcgagg
atcccgtcctcggacgaagacgagctcttgattcacacaacagccccctccttgcccgtt
gtggaggaacatgagaccgaacaaccgccgaaaagccaggaaaaagcctggtttttcgga
ggagggacgctcttccccacggctagcaagggacttcccaggctgttcccagatcagacg
gacggggacagaatcatcgaacaacttatgtacgtgccagaagattatcaagggtttgac
actccggagaaagtgattcttgcctacaacggtctaggcacctggggtcaaagatcaggc
cctggcagtttccacggttgtcccgtgagccggtgcagtttgactgatgatcgcagcaga
gccgccgatgccgacgcaatcctctacaaggatcattttattcaccctccagtttccaga
ccgttcaaccaagtgtggatcatgtattttttagaatgtccttaccatacccaaagtatt
aaatttcccgacgtaatcaactggacggctacttatcgcagagacagcgatctggtcgca
ccgtacgaaagatggacttacttcgaccctcaggtccgccagaaggtgcaaaaccgcgat
tacagcgcaaataagacaaaaaaagtggcttggttcgtatcgaactgtggtgcacgcaac
gggcgattggcgtacgctcgcgagctttctaaatacatccaagtggacatctacggcatg
tgtggccctttggcgtgcccccgctctgataaaaaatgtttcgatttgctggaccgcgag
tacaaattctatctagcgttcgaaaattccaactgtcgcgattacatcactgagaagttc
tatgtcaacggattaggacagaatgttctgcccattgtgatgggcgctcgcccggaggat
taccaaagaagcgctccggaagggtcttacattcacgtggacgagtttgccggacctgcc
gagctggctgcatatttaaatagactggataaagatagtacactttacaattcctatttt
aaatggaaagggacggggcagttcatcaataccttcttttggtgtagactttgtgcaatg
ctgcatgctcccagagtacatagacattacgatgatattaacgactggtggagggggccg
ggagtctgttcttccaagtcgtggagaaacgccgattttgtgtag

DBGET integrated database retrieval system