KEGG   Tribolium castaneum (red flour beetle): 655880
Entry
655880            CDS       T01046                                 

Definition
(RefSeq) TNF receptor-associated factor 4
  KO
K09848  TNF receptor-associated factor 4
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:tca00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    655880
SSDB
Motif
Pfam: zf-TRAF Alpha-amyl_C Sina
Other DBs
NCBI-GeneID: 655880
NCBI-ProteinID: XP_008195944
Position
LG9
AA seq 437 aa
MWANTEFLELRNSHDTFFNVSEGLFTGPESSVPIDYAKIYPDPESEKAIMSSVVYCIHHK
EGCKWSDELRKLKAHLNSCKHDAIPCTGKCGAQIPRVIMDEHLKTTCPQRRARCQFCNKE
FTGLVFENHVGNCGYEPLYCENKCGVKVARRHLSQHKVSECSKRLLPCRFCSKEFVADTL
SAHHLKCGRVPVACPNRCDVNVLAKEDLETHLKEECTVSVLSCTYKDAGCRFKGPRYLME
KHLEESSQQHLALVCTVVTKQQHQITSLKNALSRLSLNYSGTLIWKISDFSEKMTEAKNK
EGMELVSPPFYTSQYGYKLQASLFPNGNGAGEDSHISVYIKILPGEYDALLRWPFAHSVS
FTLFDQSSCPEKACNIVESFIPDPTWKNFQRPSKEPDSLGFGFPKFVSHEMLKKRHFMKD
DTMFIRVKVDPSKIVAV
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgtgggcaaataccgaatttctcgaattgcgcaatagtcacgacaccttttttaatgta
agtgaaggtttattcactggaccggagagcagtgtcccgatcgattacgccaagatctat
cccgacccggagtcggagaaggctattatgagctctgtcgtttactgcatacaccataag
gaaggctgcaaatggtcagatgagctcagaaaattgaaggcccacctaaactcgtgcaaa
cacgacgccatcccctgcaccggcaaatgcggcgcccaaatcccgagagtcatcatggac
gagcacctcaaaaccacttgtcctcagcggcgcgccaggtgccagttctgcaacaaggag
ttcaccggcctagttttcgagaaccacgtgggcaactgcggctacgagcccctctactgc
gagaacaaatgcggagtcaaagtggcaagacgccacttgagccaacacaaagtgagcgag
tgctcgaaacgactcctcccgtgcagattttgctcgaaggaattcgtcgctgacacactt
tccgcacaccatttgaagtgtggaagggttccagtggcgtgccccaacaggtgcgacgtc
aacgtgctcgcaaaagaggatttggagacgcacctgaaggaggaatgcaccgtgtcagtg
cttagttgcacctacaaggacgcaggatgccgctttaaggggcctagatacttaatggag
aagcatttggaggaaagcagtcaacaacatttagccctagtttgcaccgttgttacgaaa
caacaacaccaaatcacctcacttaaaaacgccctctccaggctatccctcaactactct
gggaccctaatctggaaaatcagcgacttttccgaaaaaatgaccgaagcaaagaataaa
gaggggatggagttggtctcgccgcctttctacactagtcaatacggatacaaacttcag
gcttcactcttccccaatggaaacggtgccggcgaagactcccacatttccgtctacatt
aaaatccttccaggggaatatgacgccctcttgcgctggcccttcgcccactccgtctcg
ttcaccctctttgaccagtcctcctgtccggagaaagcgtgcaatattgtggaaagtttc
atcccggaccccacctggaaaaacttccaaaggccgagtaaagagcccgattccttgggc
ttcgggtttcccaaattcgtgtcacatgaaatgttgaagaagaggcattttatgaaagat
gacacgatgtttattagggtaaaagttgatcctagtaagattgttgctgtctga

DBGET integrated database retrieval system