KEGG   Tribolium castaneum (red flour beetle): 655928
Entry
655928            CDS       T01046                                 
Name
(RefSeq) 40S ribosomal protein S24
  KO
K02974  small subunit ribosomal protein S24e
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    655928
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tca03011]
    655928
Ribosome [BR:tca03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    655928
  Archaea
    655928
SSDB
Motif
Pfam: Ribosomal_S24e
Other DBs
NCBI-GeneID: 655928
NCBI-ProteinID: XP_015833966
Position
LG3:22843781..22848165
AA seq 136 aa
MTEGTATIRTRKFMTNRLLCRKQMVVDVLHPGQASVKKTDIREKLAKMYKVTPDVVFVFG
FRTNFGGGKSTGFALIYDTLDFAKKFEPKHRLARHGLFEKKQQTRKQRKERKNRMKKVRG
TKKSKVGAAAKKGGKK
NT seq 411 nt   +upstreamnt  +downstreamnt
atgactgaaggtacagccacaattcgcactcgcaaatttatgaccaacagattgttgtgt
cgcaaacagatggttgtagatgttctacatccaggtcaggcgtctgttaaaaaaacagat
attagggaaaaactggccaaaatgtacaaagttacgccagatgtagtatttgtattcggt
ttccgtacaaacttcggcggtggcaaatcgacaggttttgcgttgatttacgacacgtta
gattttgccaagaaattcgagcctaaacacaggcttgcccgtcacggtctcttcgaaaag
aaacaacaaacgcgcaaacagcgtaaagaacgtaagaacagaatgaagaaagtacgcggt
accaagaagagtaaagtgggtgctgcggctaagaagggtggaaagaaataa

DBGET integrated database retrieval system