KEGG   Tribolium castaneum (red flour beetle): 656047
Entry
656047            CDS       T01046                                 
Name
(RefSeq) beta-parvin
  KO
K06275  parvin
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:tca04812]
    656047
   04147 Exosome [BR:tca04147]
    656047
Cytoskeleton proteins [BR:tca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     656047
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   656047
SSDB
Motif
Pfam: CH Ribosomal_L27 CAMSAP_CH
Other DBs
NCBI-GeneID: 656047
NCBI-ProteinID: XP_015833424
Position
LG3:11336656..11346204
AA seq 558 aa
MEEFIEKPPCQILYRQSSLETRLSPVHLSEESSESSDEEVENVNTTPKIVDVKIKTPVEK
GNENEEEKLTAVYLMKSITPPKQQTPPEKCQSELEMATLRPKSPRPVGPKNDKEESIWDK
LGTLGRKKRIKEVQEVQAEGKYAIDSPGHPTNPITPPEEYDLEDNEERCMVEPRSYDDPK
FRELSQVLIDWINDELASQRIIVQDLAEDLYDGQVLQKLLEKLTNDKLDVPEVTQSEEGQ
KQKLSVVLAHFNQVLGVQRLGHKKWSVEAIHSKNIVPILHLLVALARHFRPPVRLPEHVS
VTVVVVQKVGGQLSHRIVKESITTAYDDVGMRCERDAFDTLFDHAPDKLQVVKKSLVTFV
NKHLNKINLEVSDLETQFHDGVYLIMLMGLLEGFFVPLYSFHPTPRDFEQKVHNVSFAFE
LMEEVGLKRPKARPEGTSVRFASKKTGGSTQNTHTKVRPKHRGWKVQDGHRVEAGSILAT
QRNLRFHPGLNVGFGRNGTLFAIVPGRVVVTCEKVDLNWTHTWVQRCHGLRQDKEFYKKY
FNILPDKQHQNFKLIDQI
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggaagaatttatagaaaagccaccttgccaaattttataccgacaatcttcgttggaa
actcgcttatctcccgttcacttgtctgaagaatcatccgaatcaagtgatgaggaagtg
gaaaatgttaacaccacacccaaaatagtggacgttaaaataaaaacaccagtagaaaaa
ggcaacgaaaacgaggaggaaaaattaacagcggtatatttaatgaaaagcatcacacca
ccaaaacaacaaactcccccagagaaatgtcaaagtgagttagaaatggcgacacttcgg
cctaaatcacccaggcctgtggggcccaaaaacgataaggaggagtcgatctgggacaag
cttggtacacttgggcgcaagaaacgcatcaaggaagtgcaagaggtgcaagctgagggc
aaatatgcgattgattctccggggcatcccacaaaccccatcacaccgccagaagagtac
gatttggaggacaatgaggagcgctgcatggtggagccccggtcgtacgacgaccccaaa
ttcagggaactctcccaagtactgatcgactggatcaatgacgaattggcctcacagcga
atcattgtgcaagacctagctgaggacttgtatgatgggcaagtgttgcaaaaacttctc
gaaaagctaacaaatgacaaactcgacgttcccgaagtcacccagtctgaagaaggccaa
aagcagaaactttcggtcgttttggcacatttcaaccaggttttgggggtgcagcgtttg
gggcacaagaaatggagtgtggaggctattcattcgaaaaatatcgtcccaattttgcat
ttattggtcgctttggcgcgacatttcagaccaccagttcgtcttcctgaacatgtctct
gtcacagttgtggtggtccagaaagtggggggccaattgagtcacagaattgttaaagaa
agcattaccactgcctatgatgatgtcgggatgaggtgtgagagggatgcgtttgataca
ttgtttgatcatgcccccgataaactccaagttgtaaaaaagagtctcgtaacattcgtc
aacaaacacttgaacaaaatcaatttggaagtgagtgatcttgaaactcaattccatgat
ggggtctatttaattatgttgatgggtcttttggagggattttttgtacctttgtacagc
ttccatcctactccaagggattttgagcaaaaagttcacaacgtctcgttcgcttttgaa
ctcatggaagaagtcgggttgaaaagaccaaaagcacgacctgaaggtacttccgttagg
ttcgcaagtaaaaaaaccgggggaagtacccaaaatacgcacacgaaagtgcgccccaaa
catcgcggctggaaagtgcaggatgggcacagggttgaggctggttccattttagcgact
caacgcaatttacgttttcatcccgggttaaatgtgggttttggccgcaatggcacttta
tttgctatagttccaggccgtgttgtggtgacgtgtgaaaaagttgatctcaattggact
catacttgggtgcagcggtgtcacggtttgagacaagacaaggagttttataagaaatat
ttcaatattttgccagataagcagcatcaaaatttcaaactgattgatcaaatttga

DBGET integrated database retrieval system