KEGG   Tribolium castaneum (red flour beetle): 656087
Entry
656087            CDS       T01046                                 

Definition
(RefSeq) glutamine synthetase 2 cytoplasmic
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00220  Arginine biosynthesis
tca00250  Alanine, aspartate and glutamate metabolism
tca00630  Glyoxylate and dicarboxylate metabolism
tca00910  Nitrogen metabolism
tca01100  Metabolic pathways
tca01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    656087
  09102 Energy metabolism
   00910 Nitrogen metabolism
    656087
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    656087
   00220 Arginine biosynthesis
    656087
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tca04147]
    656087
Enzymes [BR:tca01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     656087
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   656087
SSDB
Motif
Pfam: Gln-synt_C Gln-synt_N
Other DBs
NCBI-GeneID: 656087
NCBI-ProteinID: XP_008191347
Position
LG3
AA seq 371 aa
MTMPNTTLENSPNAVLNKSVAERYMHLPCPENKVKATYIWIDGTGENVRAKTRTVDFVPK
KPEELPVWNYDGSSTYQAEGTNSDTYLCPVAIYNDPFNGGNHKLVMCDTYKYNKKPTETN
HRHTCLQAMEAAKDTKPWFGIEQEYTLLDMDMRPLGWPKNGFPGPQGPYYCGVGANKVYA
RDIVESHYSACLYAGINIAGTNAEVMPAQWEYQVGPCEGISIGDELWVSRYILHRVAEDF
GVIVTFDPKPIEGDWNGAGAHTNFSTKAMREDGGIIEIEKAIDKLSRNHLRHIQAYDPKG
GKDNERRLTGRHETSSIHDFSAGVANRGASIRIPRGCAEDKKGYLEDRRPSSNCDPYAVC
EALVRTCILDE
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgacgatgccgaatacaacccttgagaactcacccaatgcggtgctcaacaagtcagtg
gctgaaaggtacatgcatttaccgtgccccgaaaataaggtaaaagccacctacatatgg
attgatgggactggtgaaaatgtcagggcgaaaacacgcacagtcgatttcgtcccaaag
aaacccgaagagttgccggtttggaactacgacggcagttccacataccaagccgaaggc
accaactctgacacatatctatgtcctgtcgccatctacaacgaccccttcaatgggggc
aaccacaagttggtcatgtgcgacacctacaaatacaacaaaaaaccaaccgaaactaac
caccggcacacgtgtctgcaagccatggaggcggctaaagacaccaaaccttggttcggt
atcgagcaggagtacactttgctcgacatggatatgagacctttggggtggcccaagaat
gggtttccgggaccccaagggccttactattgcggtgtgggggctaataaggtctacgca
cgtgatattgtagagtctcactacagtgcttgtctgtatgctggtattaatattgctgga
accaatgctgaggtcatgccagctcaatgggagtatcaggttggtccctgtgagggtatt
tccatcggggatgaattgtgggtctcgaggtatattttgcatcgtgtcgccgaagatttt
ggggttattgtcacgtttgatcctaagccgattgaaggcgattggaatggagcgggggct
catactaacttctccactaaggcgatgagagaagatggaggaattattgaaatcgagaaa
gccatcgataagctcagccgaaaccaccttagacacatccaggcctacgatcctaaggga
ggaaaggacaacgaacgtcgtctcaccggtcgccatgaaacttcctcgatccatgacttc
agtgcaggtgtggctaaccgtggcgcgagtattcgtattcctcgcggatgtgcagaagat
aagaagggatatcttgaagataggagaccatcttcaaattgcgatccgtacgcagtatgt
gaagctttggtccgaacatgtattctagatgaataa

DBGET integrated database retrieval system