KEGG   Tribolium castaneum (red flour beetle): 656124
Entry
656124            CDS       T01046                                 
Name
(RefSeq) calcyclin-binding protein
  KO
K04507  calcyclin binding protein
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    656124
SSDB
Motif
Pfam: Siah-Interact_N CS SGS MCR_C
Other DBs
NCBI-GeneID: 656124
NCBI-ProteinID: XP_967766
BEETLEBASE: TC010306
UniProt: D7GXT5
Position
Un
AA seq 220 aa
MSGKIDELKKDLAELQALEAQATRHKVKDFLSLEVRKISTEITKLQEQLNTTTVPTPVTS
TNKRYRVKLNNYAWDQTSKFVKFYVTLPKVQTIPPENVVCHFTNKSLELEVRDLENKDYV
FTINNLLGAVDPAASNWKIKSDMVVINASKVKGDPWSHVTELEKKVDDAQKAKFKTGDNV
DPNEGIMSLMKNMYETGDDEMKRTIAKAWTESQMKSSSLS
NT seq 663 nt   +upstreamnt  +downstreamnt
atgtccggaaaaattgacgaactcaaaaaagacttggccgagcttcaagctctcgaagct
caagcaacgcgccacaaagtcaaagactttttgtcgctggaagttaggaaaatctcaacg
gaaataactaaattacaagagcaattaaacacaaccactgttccaacaccagtcacttca
acgaataagcgctatcgcgtcaaattaaacaattacgcttgggatcaaacatcgaaattt
gtgaaattctacgtcactttgcccaaagttcagaccattccgcctgaaaatgtcgtttgc
cacttcacgaataagtcgctagagctggaagtgagagatctcgaaaacaaagattacgtc
ttcactattaacaatcttctgggggctgttgacccagcggccagtaattggaagattaag
tcagatatggtggtaataaatgcatcaaaggtcaagggggacccctggtctcacgtgact
gagcttgagaaaaaagtagatgatgcacaaaaagccaaattcaaaactggggataatgtg
gaccccaatgagggcattatgtcactaatgaagaatatgtatgagacaggcgatgacgaa
atgaaaaggacaattgctaaagcctggactgagagtcaaatgaaatcgtcatccttatcc
taa

DBGET integrated database retrieval system