KEGG   Tribolium castaneum (red flour beetle): 656304
Entry
656304            CDS       T01046                                 
Name
(RefSeq) 40S ribosomal protein S21
  KO
K02971  small subunit ribosomal protein S21e
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    656304
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tca03011]
    656304
Ribosome [BR:tca03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    656304
SSDB
Motif
Pfam: Ribosomal_S21e
Other DBs
NCBI-GeneID: 656304
NCBI-ProteinID: XP_967937
UniProt: D6X125
Position
LG9:1080105..1083044
AA seq 83 aa
MENDAGEFVDLYCPRKCSASNRIIHAKDHASIQLSIAEVDPQTGRMTDTSKSYALCGAIR
RMGESDDCIVRLTKKDGILAKNF
NT seq 252 nt   +upstreamnt  +downstreamnt
atggaaaacgacgcaggtgaatttgttgacttgtattgtccaaggaaatgctcagcaagt
aaccgaattattcatgccaaggatcatgcttccattcagttgagcattgctgaggttgat
ccccagactggaaggatgaccgacacctcaaaaagttacgctttgtgtggggctattaga
agaatgggggaatctgacgactgtatcgttagattgaccaagaaagatggaattcttgca
aagaacttctaa

DBGET integrated database retrieval system