KEGG   Tribolium castaneum (red flour beetle): 656416
Entry
656416            CDS       T01046                                 
Name
(RefSeq) 60S ribosomal protein L18
  KO
K02883  large subunit ribosomal protein L18e
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    656416
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tca03011]
    656416
Ribosome [BR:tca03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    656416
  Archaea
    656416
SSDB
Motif
Pfam: Ribosomal_L18 Ribosomal_L27A
Other DBs
NCBI-GeneID: 656416
NCBI-ProteinID: XP_968042
UniProt: D6WDJ4
Position
LG3:12172431..12173380
AA seq 188 aa
MGIDINHKHDRKVRRTEPKSQDVYLRLLVKLYRYLARRTGSKFNKIILKRLFMSKINKPP
ISLARVVRAMKKPGREGLTAVIVGTVTDDARIWEVPKLSICALRVTGTARARILKAGGEV
ITFDQLALRAPTGAKTVLLQGRRNAREAVKHFGPAPGVPHSHTKPFVRTKGRKFERARGR
RRSCGYKK
NT seq 567 nt   +upstreamnt  +downstreamnt
atgggtatcgacattaaccataaacacgaccgtaaggttaggcgcaccgaacccaaaagc
caggatgtgtatttacgccttttagttaagttgtaccgttatttggcccgccgcacgggc
tccaaattcaacaaaatcatcctcaaacgcctgtttatgagcaaaatcaacaagccccca
atttccctcgcacgagtcgttcgggcgatgaaaaagccgggccgtgaaggcctcactgct
gtcattgttggaaccgtgacagacgacgcacgaatctgggaagtccccaaactgtcaatt
tgtgcacttcgtgttactggaactgccagagccaggattctgaaagcgggcggtgaagtg
atcacttttgatcagttggcgctgagggcccccactggagccaaaactgtgcttttacaa
gggagacgcaacgctcgtgaagctgttaaacactttggaccggctcctggtgtgccacat
tctcacactaagccgtttgtgagaaccaagggaaggaagtttgagagggctcgcggccgc
aggcgctcatgtggatacaaaaaataa

DBGET integrated database retrieval system