KEGG   Tribolium castaneum (red flour beetle): 656438
Entry
656438            CDS       T01046                                 

Name
(RefSeq) 40S ribosomal protein S3a
  KO
K02984  small subunit ribosomal protein S3Ae
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    656438
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tca03011]
    656438
Ribosome [BR:tca03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    656438
  Archaea
    656438
SSDB
Motif
Pfam: Ribosomal_S3Ae Abhydro_lipase
Other DBs
NCBI-GeneID: 656438
NCBI-ProteinID: XP_968064
UniProt: D2A5H6
Position
LG6:2069372..2070747
AA seq 267 aa
MAVGKNKGLSKGGKKGVKKKIVDPFTRKDWYDVKAPSMFATRQVGKTLVNRTQGTKIASE
GLKGRVFEVSLADLQNDNDAERSFRKFRLIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKW
QTLIEASADVKTTDGYLLRVFCIGFTNKDQLSQRKTCYAQHTQVRGIRKKMVEIITRDIT
GSDLKEVVNKLLPDSIAKDIEKACQGIYPLHDVYIRKVKVLKKPRFELSKLLELHGDGGK
GGSGEPGEAGAKVDRPEGYEPPVQESV
NT seq 804 nt   +upstreamnt  +downstreamnt
atggcagttggtaaaaataaggggctgtccaaaggcggcaaaaagggcgttaagaagaag
attgtggacccgttcacccgcaaagactggtacgatgttaaggccccctcgatgtttgcc
accaggcaggtgggcaagacgctggtgaaccgtacgcagggtacgaaaatcgcgtccgag
gggctcaaggggcgcgtgtttgaggtgtctttggccgacttgcagaatgataatgatgct
gagcggtcgttcaggaagttcaggctcattgccgaggatgttcaaggtcgcaacgtcctg
accaacttccacggcatggacttgaccaccgataagttgcgttcaatggtcaaaaagtgg
caaactttgattgaagcctcagctgatgtcaaaaccaccgatggttatttgttgcgtgtt
ttctgcatcggcttcaccaataaggaccagttgtcgcaacgtaaaacttgttacgcccaa
catacccaggtccgtggcattcgcaagaagatggtggaaatcatcacccgggacatcacc
gggagtgacctcaaggaagtcgtaaataaactacttccggattcgatcgcgaaagacatt
gaaaaggcctgccaggggatttacccacttcatgacgtgtacattcgtaaagtgaaagtc
ttgaagaagccgcgttttgagctttccaagcttttggaattgcacggggatgggggcaaa
ggggggtcgggtgagcccggggaagcgggtgctaaagtggacagacccgaaggatatgaa
ccaccagtccaagagtctgtttaa

DBGET integrated database retrieval system