KEGG   Tribolium castaneum (red flour beetle): 656451Help
Entry
656451            CDS       T01046                                 

Definition
(RefSeq) heat shock 70 kDa protein II
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03040  Spliceosome
tca04141  Protein processing in endoplasmic reticulum
tca04144  Endocytosis
tca04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    656451
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    656451
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    656451
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    656451
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tca01009]
    656451
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tca03041]
    656451
   03009 Ribosome biogenesis [BR:tca03009]
    656451
   03110 Chaperones and folding catalysts [BR:tca03110]
    656451
   04131 Membrane trafficking [BR:tca04131]
    656451
   03051 Proteasome [BR:tca03051]
    656451
   03029 Mitochondrial biogenesis [BR:tca03029]
    656451
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tca04147]
    656451
Protein phosphatases and associated proteins [BR:tca01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     656451
Spliceosome [BR:tca03041]
 Complex B
  Other components
   Prp19 complex
    656451
 Complex C
   Prp19-CDC5 complex
    656451
Ribosome biogenesis [BR:tca03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    656451
Chaperones and folding catalysts [BR:tca03110]
 Heat shock proteins
  HSP70 / DNAK
   656451
Membrane trafficking [BR:tca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    656451
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    656451
Proteasome [BR:tca03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    656451
Mitochondrial biogenesis [BR:tca03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    656451
Exosome [BR:tca04147]
 Exosomal proteins
  Proteins found in most exosomes
   656451
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl StbA BcrAD_BadFG
Motif
Other DBs
NCBI-GeneID: 656451
NCBI-ProteinID: XP_968075
UniProt: D6WVR7
Position
LG8
AA seq 514 aa AA seqDB search
MSELVVGIDLGTTNSCIAVERNGKIEVIPNREGNRTTLSYVYYGEDSILVGKTAKYMASA
NPSNGIYEIKRLIGCLHDDPDIESERKSLNYELVRGTNGEILIQVEQNSEKFHTLPEEVC
ARILHRLKIDAEMYLGQKVSKAVVTVPAYFNNNQRAATRDAARIAGFEVLKLVNEPSAAA
LAYVRENRIKNGRVILIYDLGGGTFDVSIVRTENGTIKVLSVDGDTHLGGQDFLNRLVDH
VVDYVQTKHGIKVRENKRLMMNILNSCEKTKKILTSANRTVIPLEFSGHFDQLEVTREQF
EELNRDLFAKTVKILDNCIRNRRMSKEEIDEVLLVGGSSRIPRIETLLKAYFDKPIQRNI
NADEAIAIGAALEAHHFAQTHHNSLLIDVLPLSIGTVFDEETIFFNFARNTPLPANSKHV
HVFKNRKQKNCILSVYEGGHLDCNKNVLLGAHEIKWTATTKKNRNVEITMQINNYGIIWV
TARGESIKTFSIALNKGRLEDDEIRKLSRGLQVS
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaattggtggtcggaattgacttaggaacaacgaattcttgtattgccgttgaa
cgaaacggtaaaatcgaggtaataccgaatcgcgaaggcaacagaaccacgttatcgtac
gtttattatggcgaagacagcatccttgttggcaaaacggccaaatacatggccagcgcc
aatccatcaaacggcatttacgagatcaaaagactgatcggctgtttgcacgacgaccct
gatatcgaatccgagcgcaaatcgctaaattatgagttggtccgcggcaccaacggcgag
attttgatccaagtcgagcaaaactcggagaaatttcacactttaccggaggaagtgtgc
gccaggatcctccaccgtctgaaaatcgacgctgaaatgtaccttggacagaaagtgagc
aaagcggtggtcaccgtccccgcgtacttcaacaacaatcaaagggcagcgactcgggac
gccgccagaatcgccggcttcgaagtgctgaagctggtgaacgaacctagtgctgccgct
ctggcctacgtccgcgaaaatcgcatcaaaaacggccgagttatcctaatttacgacctg
ggtggtggcacctttgatgtgtccattgtccggacagagaacggaacaatcaaagtgcta
tcagtcgacggtgacacgcatctaggaggccaggattttctgaaccgccttgtagaccac
gtggtcgattacgtgcaaaccaaacacgggataaaagtgcgcgaaaacaaacgcttgatg
atgaacattttgaattcgtgcgagaaaaccaaaaaaattctgacaagtgcaaaccgaacc
gtcatcccgctggaattcagcggccacttcgaccagttggaagtcacacgtgaacagttc
gaggagctaaaccgcgatctcttcgccaaaacggtcaaaatcctcgacaactgcatcagg
aaccgacgaatgagcaaggaggaaattgacgaggttttgctagtcggaggctcctcgagg
attccccggattgaaaccctcctcaaagcctacttcgacaaacccatccagcgcaacatc
aacgccgacgaggccatcgccataggggcggcccttgaagcccaccatttcgcccaaacc
caccacaattcgctcctaattgacgtgcttccactttcaatagggacggttttcgacgaa
gagaccatttttttcaatttcgcgcgcaacacgccgctcccagccaactccaaacacgtc
catgttttcaaaaatcgcaaacaaaagaactgtattttgtcggtgtacgagggggggcat
ttggattgcaataaaaacgtcctgttgggggcgcacgaaatcaaatggacggccacaacg
aaaaagaacagaaatgtcgaaattacgatgcaaattaacaattatgggattatttgggtg
acggcgagaggcgagtcgattaagacgttcagcattgcgctgaataagggacgacttgaa
gacgacgaaattcggaaattgagccgaggattgcaagtctcgtaa

DBGET integrated database retrieval system