KEGG   Tribolium castaneum (red flour beetle): 656485
Entry
656485            CDS       T01046                                 

Definition
(RefSeq) FK506-binding protein 59
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    656485
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tca01009]
    656485
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:tca03021]
    656485
   03019 Messenger RNA biogenesis [BR:tca03019]
    656485
   03041 Spliceosome [BR:tca03041]
    656485
Enzymes [BR:tca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     656485
Protein phosphatases and associated proteins [BR:tca01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     656485
Transcription machinery [BR:tca03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     656485
Messenger RNA biogenesis [BR:tca03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     656485
Spliceosome [BR:tca03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    656485
SSDB
Motif
Pfam: FKBP_C TPR_2 TPR_1 TPR_8 TPR_16 TPR_17 TPR_6 TPR_9 TPR_12 TPR_11 FKBP_N_2 TPR_14 TPR_19 DUF489 ANAPC3 SPO22
Other DBs
NCBI-GeneID: 656485
NCBI-ProteinID: XP_008192785
UniProt: D2A1L1
Position
LG4
AA seq 454 aa
MLEPIDISPNQDKGVLKEILREGTSDECPPPGSKVRVHYTGTLTDGTKFDSSRDRNEPFE
FDLGKGSVIKAWDIGVATMKKGEQAMLTCAPEYAYGKSGSPPTIPPDATLKFDVEVISWK
CEDLSPKKDGGIERAQIKAGEGYTYPNDGATVEVHLIGKYENKEFDVRDVTFTVGEASEQ
NVISGIDIAIEKFKKGETSKLIIKPQYAFGTEGCSEFNIPPNATVEYTVTLKNFERVKES
WALDTKERVEQSKIFKEKGTNYFKANKFQLAIKMYKKIIEYLESQKDPELDKEIESLNLA
AHLNLSLCYLKIDDNFEAKASATAALKMDPDNVKALFRRGQALLKLGEPKLASEDFQQCL
KLDPGNTAAQSQKALCVKTLKEQLEKEKKVFANMFDRFAKVDAQREEKEKKKEPNVMSSV
GEWGKEDREREPSEFEKENPNILLLSGSGEFKDM
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgcttgaacctattgatatttccccaaatcaagacaagggagtcctcaaggaaatcctt
cgggagggtacaagtgacgagtgccctccacctggatccaaagtcagagttcactacact
ggaactctaactgatggcacaaaattcgactctagtagagaccggaacgagcctttcgag
tttgatttgggcaaagggagtgtgattaaagcatgggacatcggtgtggccactatgaaa
aagggggagcaagctatgctcacatgtgcacccgaatacgcctacggcaagtctggcagt
cctccaactattccaccagacgccacgctgaaatttgatgttgaagtaatcagttggaag
tgcgaggatttgagccctaagaaagacgggggtattgaaagggcccaaattaaggcgggt
gaagggtacacgtatcccaacgatggggctaccgttgaagtgcatttgattggtaaatac
gaaaacaaggaatttgatgttcgtgatgtcacgtttacggttggggaagcctcagaacag
aatgtcatttccggtattgacattgccattgaaaaattcaaaaagggggaaacttcaaaa
cttataatcaagccacaatatgcatttggaactgagggttgttcagaattcaacattcca
ccgaacgcaacggttgaatacaccgtcacgttgaagaactttgaaagagttaaagaaagt
tgggctcttgacaccaaagaacgtgtggaacaatcaaaaatcttcaaggagaaaggaacg
aattattttaaagctaacaaatttcaactagccataaaaatgtacaaaaaaattattgag
tatttggaatctcagaaagatccggaactggataaagaaatagagtcgttaaatttagct
gcgcatctgaatttgtcgttatgttacttgaaaattgacgacaatttcgaagctaaagcc
tcggctaccgccgctttgaaaatggatccagacaatgttaaagctttgtttagaagaggt
caggctttactaaaactaggagagcccaagcttgcttccgaagatttccagcagtgtttg
aagctggatccaggaaatacagctgcacagagtcagaaagccctttgtgtgaaaacactc
aaagaacagttagagaaggagaagaaggtttttgctaatatgtttgacagatttgcgaaa
gtggatgctcagagggaagaaaaagagaaaaagaaagagccgaatgtgatgtcgtcagtg
ggtgaatggggtaaggaagatcgtgagcgagagccgagtgagtttgagaaggaaaatccg
aatattttgttgcttagtggcagtggagaatttaaggacatgtag

DBGET integrated database retrieval system