KEGG   Tribolium castaneum (red flour beetle): 656496
Entry
656496            CDS       T01046                                 

Definition
(RefSeq) protein groucho
  KO
K04497  groucho
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04013  MAPK signaling pathway - fly
tca04310  Wnt signaling pathway
tca04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    656496
   04310 Wnt signaling pathway
    656496
   04330 Notch signaling pathway
    656496
SSDB
Motif
Pfam: TLE_N WD40 ANAPC4_WD40 SufE HALZ APG17
Other DBs
NCBI-GeneID: 656496
NCBI-ProteinID: XP_008190395
UniProt: A0A139WM63
Position
LG2
AA seq 748 aa
MYPTPARHPSAAGPPPQGGQLKFTIADTLERIKEEFNFLQAQYHTLKLECEKLASEKTEM
QRHYVMYYEMSYGLNVEMHKQTEIAKRLNAIIAQVLPFLAQEHQQQVATAVERAKQVTMT
ELNAIIGQQQQQGLQQLLQQIHAQQLPHGPHGPGLPIGPHPGLPGMAPAAAAGLLGFGAG
LGAGVPGAPTGPHASVTGGAHPLLKSADLHSREAVDIKPGSANAEERLNSVSPGDRDKYR
SRSPPDVEQDVKRRKEDKLGHESDGEKSDQDLVVDVANEEASSPHTNGDHAPLSNSGVEI
RENGSTNGDKIKVERPPSRSGSSSSRSTPSLKSKDEKPLTPGSKPRSTTPNLGATPGASG
PKVALGQYPPYSLAAPREHLSPYNNVAPSYGRPPLMGYDGHPHARTPGIATNGLSSIPGG
KPAYSFHMNGEGQLQPVPFPTDALIGPGIPRHARQINTLNHGEVVCAVTISNPTKYVYTG
GKGCVKVWDISQPGSKTPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLASP
TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCI
DISSDGTKLWTGGLDNTVRSWDLREGKQLQQHDFSSQIFSLGYCPTGEWLAVGMENSHVE
VLHALKPDKYQLHLHESCVLSLRFATCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSV
LSCDISTDDKYIVTGSGDKKATVYEVIY
NT seq 2247 nt   +upstreamnt  +downstreamnt
atgtaccccacccctgcaaggcatccatcggccgcgggaccaccacctcaaggtggtcaa
ctcaaattcaccattgccgacactctggaacggattaaggaagaattcaacttccttcaa
gcccaatatcacacgctcaaattagagtgtgaaaaactggctagtgaaaagactgaaatg
caacggcactacgttatgtattacgaaatgtcttatggccttaacgtagaaatgcataaa
cagactgaaatcgcaaaacgcttaaacgcaattatcgcccaagtgctgccgtttctggcc
caagaacatcaacagcaagtggcaacggcagtcgaaagagccaaacaagtcacgatgact
gaacttaatgcaataattgggcaacaacaacaacaaggtcttcaacaattgcttcaacag
atccacgcccaacaactccctcatggtcctcacggtccaggcttacccatcggtcctcat
cccggccttccaggaatggcaccagccgctgctgctggtcttttgggatttggggcggga
ttaggagcgggtgttccaggagcaccaacaggaccacacgcttctgtaaccggaggcgct
catcctttactaaaatcagcagatctccattccagggaagccgtcgacatcaaacctgga
tcggctaatgccgaagaaagactgaattctgtttcgcccggagacagagataaatacaga
tcgagatcgccgccagacgtggaacaggatgtcaagagacggaaagaagataaattaggc
catgagagcgacggcgagaagagtgaccaagacctagttgtggacgtcgccaacgaggaa
gcctcctccccgcacaccaacggtgatcacgccccccttagcaattccggtgtcgaaatc
cgtgaaaacggcagcacaaacggcgataaaatcaaagtggaacggcctccaagtcgtagc
ggctcctcctcgtcccgcagcaccccatccctcaaaagtaaagatgaaaaacccctgact
ccgggctcaaaaccccgttctacgacaccgaatctaggtgcgacacctggagccagcggc
cccaaagtcgcactgggacaatatcccccttacagtttggcagccccccgtgaacacctt
agtccttataataacgtagcaccatcgtacggacgtccacctttaatgggttacgatgga
catccgcatgcacggactcctggaattgcaacgaacggtttaagttcgattccaggaggt
aaaccggcctattcgtttcatatgaacggtgaaggacaattacaaccggtgccgtttccg
accgatgcgctcatcggaccggggattccccgacatgcgcgacaaattaatacattaaat
catggcgaagttgtgtgtgctgtgaccatctcgaatccgaccaaatatgtctatacgggg
ggcaaaggctgtgttaaagtctgggacatcagtcagccagggtccaagacaccggtgtct
caactggactgcttgcaaagggataactacatccgctctgtgaagctcctcccggacggg
cgcaccctcatcgtcgggggcgaagccagcaacttgtccatttgggacctcgccagcccc
acaccacgtatcaaagccgaactgacctctagtgcccccgcgtgctacgccctcgctatc
agccccgactcgaaagtgtgtttcagttgttgttcggacggaaatatcgccgtttgggac
cttcacaatcagactttagtgcgtcaatttcaaggacatacggatggtgcttcgtgtatt
gatatttcgtccgatggtacgaaattatggacgggcggtttagataatacagtgcgaagt
tgggacttacgtgaaggcaaacaactgcaacagcacgacttcagttcgcagattttctcg
ttagggtattgtccgacgggagagtggttggctgtaggaatggagaactcacacgttgaa
gtgttgcacgcgttaaaaccggacaaataccaattgcatctgcacgaaagttgtgttctt
agtttaaggtttgccacgtgcggaaagtggtttgtgtcgacgggcaaggacaatttgctt
aatgcgtggcggacgccctatggagccagcatattccagtcgaaagaatcgtcaagtgta
ttgagttgtgacatttcaacggacgataaatacattgtgacgggctctggtgataagaag
gccacagtttacgaagtgatttattaa

DBGET integrated database retrieval system