KEGG   Tribolium castaneum (red flour beetle): 656515
Entry
656515            CDS       T01046                                 

Definition
(RefSeq) general transcription factor IIF subunit 2
  KO
K03139  transcription initiation factor TFIIF subunit beta [EC:3.6.4.12]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    656515
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:tca03021]
    656515
Enzymes [BR:tca01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     656515
Transcription machinery [BR:tca03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIF
     656515
SSDB
Motif
Pfam: TFIIF_beta TFIIF_beta_N TUG-UBL1
Other DBs
NCBI-GeneID: 656515
NCBI-ProteinID: XP_968134
UniProt: D6WKW8
Position
LG5
AA seq 266 aa
MSKDSHIDRDLDLSNATRGVWLVKVPKYVANRWEKAPSDMEVGKLKITKNGTPPQVSLTL
SSAILNLNEPGEESIPKDHRLDVSKVTQQTLGVFSHVIPTQTDAVVPETEKLYMEGKIVQ
KLECRPYADNCYMKLKLESIRKASLPTRKVKQLDRVVTSYKPVSDHKNNIEYMERKKAEG
KKARDDKDAVLEMLFAAFEKHQYYNIRDLVKITKQPITYLKEILKEVCNYNLKNPHKNMW
ELKPEYRHYKQPEVADDKKDSQSDDD
NT seq 801 nt   +upstreamnt  +downstreamnt
atgtcgaaagattcgcatattgatcgagatttagacttgtctaatgcaacgcgtggcgtg
tggttggttaaagtcccaaaatacgtggcaaacaggtgggagaaagcccccagtgatatg
gaagttggcaagctaaaaatcacaaagaacggaacacccccgcaggtgtcactaacccta
tcttcagcgattttaaacttgaatgaacctggggaggaaagtatccccaaagaccaccgc
ttagacgtgtccaaagtgacacagcagacgttaggagtgttttcacacgtgatacccact
caaaccgatgctgttgtacctgagacggaaaagttgtacatggagggcaaaatcgtccaa
aaacttgaatgtaggccttatgccgataactgctatatgaagcttaaactagagtcaatc
aggaaagcgtcgttaccgacacgcaaagttaaacaactcgatagagtcgtcacatcttac
aaaccagtctcggatcacaaaaataacatcgaatacatggagaggaaaaaagctgagggc
aaaaaggctcgtgacgataaagacgctgtcttggaaatgttatttgcggcatttgaaaaa
catcaatattacaatattagggatttagtgaagattaccaaacaaccaattacgtattta
aaggaaatcctcaaggaagtgtgtaattacaatttaaaaaatccccataaaaatatgtgg
gagttgaaacccgagtataggcattacaagcaaccggaagtggccgatgataagaaagac
tcgcagtcagatgatgactga

DBGET integrated database retrieval system