KEGG   Tribolium castaneum (red flour beetle): 656863
Entry
656863            CDS       T01046                                 

Name
(RefSeq) proteasome subunit alpha type-4
  KO
K02728  20S proteasome subunit alpha 3 [EC:3.4.25.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03050  Proteasome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    656863
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tca01002]
    656863
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:tca03051]
    656863
Enzymes [BR:tca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     656863
Peptidases and inhibitors [BR:tca01002]
 Threonine peptidases
  Family T1: proteasome family
   656863
Proteasome [BR:tca03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    656863
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 656863
NCBI-ProteinID: XP_968456
UniProt: D6WSJ0
Position
LG7:15112606..15115954
AA seq 258 aa
MARRYDTRTTIFSPEGRLYQVEYAMEAISHAGTCLGILANDGILLAAERRNTNKLLDEVF
TSEKIYKLNDDMVCSVAGITSDANVLTNELRLIGQRYLFQYGESMPCEQLVSWLCDVKQA
YTQYGGKRPFGVSILYMGWDKHYGYQLYQSDPSGNYSGWKATCIGNNSAAAISSLKQEYK
EGEMTLEDAKTLAIKVLVKTLDMTKLTAEKVEMATLSRVNNKTVIRILTSKEVEELINQY
EKKEADAEALKKEQKTAS
NT seq 777 nt   +upstreamnt  +downstreamnt
atggctcgtcggtatgatacgcggactacgatattttccccggaagggaggttgtatcaa
gtggagtatgcaatggaagccatcagtcatgcaggcacttgtttggggatcctagccaat
gatgggattcttcttgctgctgaaagacgcaatactaacaaattgctggacgaagtattc
acttcagaaaaaatctacaaactcaatgatgatatggtctgcagcgtggctggtatcact
tcagatgcgaatgtcttaactaatgagcttcgcttgattgggcaaaggtacctgtttcag
tatggcgaatcaatgccttgtgaacaattggtttcttggttgtgcgacgttaaacaggca
tatacgcaatatggaggaaaacgtccttttggtgtttcaattttgtacatggggtgggat
aaacattatggctatcaattgtaccaatcagatcctagtgggaattacagtggttggaaa
gcaacatgcattggaaataatagcgctgctgccatctccagtttgaaacaagaatacaag
gagggtgagatgactcttgaagatgccaagactttagcgattaaagttcttgttaaaacg
ctggatatgactaaacttacagcggaaaaagttgagatggcaactctcagtcgtgtaaac
aacaagactgttatccgcattcttacaagtaaggaagttgaagaactaattaatcagtat
gagaaaaaagaagccgacgctgaagctttgaaaaaggagcaaaaaactgcttcttaa

DBGET integrated database retrieval system